KEGG   Homo sapiens (human): 495Help
Entry
495               CDS       T01001                                 

Gene name
ATP4A, ATP6A
Definition
ATPase, H+/K+ exchanging, alpha polypeptide (EC:3.6.3.10)
Orthology
K01542  
H+/K+-exchanging ATPase alpha polypeptide [EC:3.6.3.10]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Collecting duct acid secretion
Gastric acid secretion
Drug target
Omeprazole: 
Pantoprazole: 
Lansoprazole: 
Rabeprazole: 
Esomeprazole: 
Dexlansoprazole: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    495 (ATP4A)
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    495 (ATP4A)
  Excretory system
   04966 Collecting duct acid secretion
    495 (ATP4A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.10  H+/K+-exchanging ATPase
     495 (ATP4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.1
AA seq 1035 aa AA seqDB search
MGKAENYELYSVELGPGPGGDMAAKMSKKKKAGGGGGKRKEKLENMKKEMEINDHQLSVA
ELEQKYQTSATKGLSASLAAELLLRDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAA
ICLIAFAIQASEGDLTTDDNLYLAIALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQA
TVIRDGDKFQINADQLVVGDLVEMKGGDRVPADIRILAAQGCKVDNSSLTGESEPQTRSP
ECTHESPLETRNIAFFSTMCLEGTVQGLVVNTGDRTIIGRIASLASGVENEKTPIAIEIE
HFVDIIAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLATVTVCLSLTAK
RLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNHIHTADTTEDQSGQ
TFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMG
YRDRFPKVCEIPFNSTNKFQLSIHTLEDPRDPRHLLVMKGAPERVLERCSSILIKGQELP
LDEQWREAFQTAYLSLGGLGERVLGFCQLYLNEKDYPPGYAFDVEAMNFPSSGLCFAGLV
SMIDPPRATVPDAVLKCRTAGIRVIMVTGDHPITAKAIAASVGIISEGSETVEDIAARLR
VPVDQVNRKDARACVINGMQLKDMDPSELVEALRTHPEMVFARTSPQQKLVIVESCQRLG
AIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIF
DNLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAES
DIMHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRAQ
WEDHHLQDLQDSYGQEWTFGQRLYQQYTCYTVFFISIEVCQIADVLIRKTRRLSAFQQGF
FRNKILVIAIVFQVCIGCFLCYCPGMPNIFNFMPIRFQWWLVPLPYGILIFVYDEIRKLG
VRCCPGSWWDQELYY
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggccgagaactatgagctctactcggtggagctgggtcctggccctggcggg
gacatggctgccaagatgagcaagaagaagaaggcgggtggcgggggtggcaagaggaag
gagaagctggagaacatgaagaaggagatggagattaacgaccaccagctgtcagtggcg
gagctggaacagaaataccagaccagtgccaccaagggcctctctgcgagcctggctgct
gagctgctgctgcgggatgggcccaacgcactgcggccaccacggggcaccccagagtac
gtcaagttcgcgaggcagctggccgggggcctgcagtgcctcatgtgggttgccgccgcc
atctgcctcatcgcctttgccatccaggctagtgagggggacctcaccaccgacgacaat
ctgtacctggcaatcgctctcattgctgtggttgtcgtcaccggctgctttggctactac
caggaattcaagagcaccaacatcatcgccagctttaagaaccttgtgccacagcaagcc
actgtcatccgcgatggagacaaattccagatcaacgctgaccaactggtggtgggcgac
ctggtggagatgaaaggtggggacagagtgcccgccgacatccgcatcctggcggcccag
ggctgcaaggtggacaactcctcgctgacaggggagtctgagccacagacccgctcaccc
gagtgcacgcacgagagccctctggagacccgcaacatcgccttcttctccaccatgtgc
cttgagggcaccgtgcagggcctggtggtgaacacgggcgaccgcaccatcattgggcgc
atcgcatcgctggcgtcgggggtggaaaacgagaagacacccatcgctatcgagatcgag
cattttgtggacatcatcgcgggcctggccattctcttcggtgccacattttttattgtg
gccatgtgcattggctacaccttcctgcgggccatggtcttcttcatggccatcgtggtg
gcctatgtgcctgaggggctgctggccactgtcacagtctgcctgtccctgacagccaag
cgcctggccagtaagaactgcgtggtcaagaacctggaggcggtggagacattgggctcc
acttcggtgatctgctcggacaagacagggactctcactcagaaccgcatgactgtgtcc
catctgtggtttgacaaccacatccacacagctgacaccacggaagaccagtcagggcag
acgtttgaccagtcctcggagacgtggcgggcgctgtgccgggtgctcaccctgtgcaac
cgcgccgccttcaagtccggccaggatgcagtgcctgtgcccaagcgcatcgtgattgga
gacgcatcggagacggcgctgctcaagttctcggagctgacgctgggcaacgccatgggc
taccgggaccgcttcccaaaagtctgcgagatacccttcaactccaccaacaagttccag
ctgtccatccatacgctggaggacccgcgggacccgcgacacttgctggtgatgaagggc
gcccccgagcgcgtgctggagcgctgcagctccatccttatcaagggccaggagctgccg
ctggacgagcagtggcgcgaggccttccagaccgcctacctcagcctgggaggcctgggc
gaacgcgtgctcggcttctgccagctctacctgaatgagaaggactacccgcctggctat
gccttcgacgtagaggccatgaactttccatctagcggcctctgctttgcgggacttgta
tccatgattgacccaccccgggccaccgtccctgatgctgtgctcaagtgtcgcaccgca
ggcatccgggtgatcatggtaacgggtgaccaccccatcaccgccaaggccattgcagcc
agtgtgggcatcatctcggaaggcagcgagacagtggaggacatcgctgcccgcctccgt
gtgcccgtagaccaggttaatcgcaaggatgcccgtgcctgtgtgatcaatggcatgcag
ctgaaggacatggacccatcggaactggtcgaggccctgcgcacccaccccgagatggtg
tttgcgcgcaccagcccccagcagaagctggtgatcgtggagagctgccagcggctgggt
gcgattgtggccgtcacgggggatggtgtgaatgactccccagctctgaagaaggcagac
atcggagtagccatgggcatcgctggctcagatgctgccaaaaatgcagctgacatgatc
ctgctggatgacaactttgcctccattgtgacaggcgtggagcagggtcgactgatcttc
gacaacctgaagaagtctattgcctacacattgaccaagaacatcccagagctgacaccc
tacctcatctacatcaccgtcagcgtgcccctgcccctcgggtgcatcaccatcctcttc
atcgaactctgcactgacattttcccatctgtgtccctggcatatgaaaaggccgagagt
gacatcatgcacctgcgtccacgcaacccaaagcgtgacagattggtcaacgagcccctg
gctgcctactcctacttccagattggtgccattcagtcctttgctggcttcactgactac
ttcacggcaatggcccaggagggctggttcccactgctgtgcgtggggctgcgggcgcag
tgggaggaccaccacctacaagatctgcaggacagctacggccaggagtggacattcggg
cagcgcctgtaccagcagtacacctgctacaccgtgttcttcatcagcattgaggtgtgc
cagatcgccgatgtcctcatccgcaagacgcgccgtctctctgccttccagcaaggcttc
ttcaggaataagatcctggtgatcgccatcgtgttccaggtctgcatcggctgcttcctg
tgctactgccccggcatgcccaacatcttcaacttcatgcccattcggttccagtggtgg
ctggtccccctgccctacggcatcctcatcttcgtctatgatgagatccggaagcttgga
gttcgctgttgcccagggagctggtgggaccaggaactctactattag

DBGET integrated database retrieval system