KEGG   Homo sapiens (human): 4953Help
Entry
4953              CDS       T01001                                 

Gene name
ODC1, ODC
Definition
ornithine decarboxylase 1 (EC:4.1.1.17)
Orthology
K01581  
ornithine decarboxylase [EC:4.1.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Glutathione metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:hsa00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p25
AA seq 332 aa AA seqDB search
MMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNI
DVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFE
EITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQTGSDDEDES
SEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVER
CDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQFQNPDFPPEV
EEQDASTLPVSCAWESGMKRHRAACASASINV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatgacttttgatagtgaagttgagttgatgaaagttgccagagcacatcccaaagca
aagttggttttgcggattgccactgatgattccaaagcagtctgtcgtctcagtgtgaaa
ttcggtgccacgctcagaaccagcaggctccttttggaacgggcgaaagagctaaatatc
gatgttgttggtgtcagcttccatgtaggaagcggctgtaccgatcctgagaccttcgtg
caggcaatctctgatgcccgctgtgtttttgacatgggggctgaggttggtttcagcatg
tatctgcttgatattggcggtggctttcctggatctgaggatgtgaaacttaaatttgaa
gagatcaccggcgtaatcaacccagcgttggacaaatactttccgtcagactctggagtg
agaatcatagctgagcccggcagatactatgttgcatcagctttcacgcttgcagttaat
atcattgccaagaaaattgtattaaaggaacagacgggctctgatgacgaagatgagtcg
agtgagcagacctttatgtattatgtgaatgatggcgtctatggatcatttaattgcata
ctctatgaccacgcacatgtaaagccccttctgcaaaagagacctaaaccagatgagaag
tattattcatccagcatatggggaccaacatgtgatggcctcgatcggattgttgagcgc
tgtgacctgcctgaaatgcatgtgggtgattggatgctctttgaaaacatgggcgcttac
actgttgctgctgcctctacgttcaatggcttccagaggccgacgatctactatgtgatg
tcagggcctgcgtggcaactcatgcagcaattccagaaccccgacttcccacccgaagta
gaggaacaggatgccagcaccctgcctgtgtcttgtgcctgggagagtgggatgaaacgc
cacagagcagcctgtgcttcggctagtattaatgtgtag

DBGET integrated database retrieval system