KEGG   Homo sapiens (human): 4953Help
Entry
4953              CDS       T01001                                 

Gene name
ODC1, ODC
Definition
(RefSeq) ornithine decarboxylase 1
  KO
K01581  ornithine decarboxylase [EC:4.1.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
Module
hsa_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Drug target
Eflornithine (DG00440): D00829 D07883
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    4953 (ODC1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    4953 (ODC1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.17  ornithine decarboxylase
     4953 (ODC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC
Motif
Other DBs
NCBI-GeneID: 4953
NCBI-ProteinID: NP_001274118
OMIM: 165640
HGNC: 8109
Ensembl: ENSG00000115758
Vega: OTTHUMG00000090450
Pharos: P11926(Tclin)
UniProt: P11926
Structure
PDB: 

Jmol
Position
2p25.1
AA seq 461 aa AA seqDB search
MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALP
RVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLL
LERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPG
SEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQ
TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF
QNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASASINV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaacaactttggtaatgaagagtttgactgccacttcctcgatgaaggttttactgcc
aaggacattctggaccagaaaattaatgaagtttcttcttctgatgataaggatgccttc
tatgtggcagacctgggagacattctaaagaaacatctgaggtggttaaaagctctccct
cgtgtcacccccttttatgcagtcaaatgtaatgatagcaaagccatcgtgaagaccctt
gctgctaccgggacaggatttgactgtgctagcaagactgaaatacagttggtgcagagt
ctgggggtgcctccagagaggattatctatgcaaatccttgtaaacaagtatctcaaatt
aagtatgctgctaataatggagtccagatgatgacttttgatagtgaagttgagttgatg
aaagttgccagagcacatcccaaagcaaagttggttttgcggattgccactgatgattcc
aaagcagtctgtcgtctcagtgtgaaattcggtgccacgctcagaaccagcaggctcctt
ttggaacgggcgaaagagctaaatatcgatgttgttggtgtcagcttccatgtaggaagc
ggctgtaccgatcctgagaccttcgtgcaggcaatctctgatgcccgctgtgtttttgac
atgggggctgaggttggtttcagcatgtatctgcttgatattggcggtggctttcctgga
tctgaggatgtgaaacttaaatttgaagagatcaccggcgtaatcaacccagcgttggac
aaatactttccgtcagactctggagtgagaatcatagctgagcccggcagatactatgtt
gcatcagctttcacgcttgcagttaatatcattgccaagaaaattgtattaaaggaacag
acgggctctgatgacgaagatgagtcgagtgagcagacctttatgtattatgtgaatgat
ggcgtctatggatcatttaattgcatactctatgaccacgcacatgtaaagccccttctg
caaaagagacctaaaccagatgagaagtattattcatccagcatatggggaccaacatgt
gatggcctcgatcggattgttgagcgctgtgacctgcctgaaatgcatgtgggtgattgg
atgctctttgaaaacatgggcgcttacactgttgctgctgcctctacgttcaatggcttc
cagaggccgacgatctactatgtgatgtcagggcctgcgtggcaactcatgcagcaattc
cagaaccccgacttcccacccgaagtagaggaacaggatgccagcaccctgcctgtgtct
tgtgcctgggagagtgggatgaaacgccacagagcagcctgtgcttcggctagtattaat
gtgtag

DBGET integrated database retrieval system