KEGG   Homo sapiens (human): 496Help
Entry
496               CDS       T01001                                 

Gene name
ATP4B, ATP6B
Definition
ATPase, H+/K+ exchanging, beta polypeptide
Orthology
K01543  
H+/K+-exchanging ATPase beta polypeptide [EC:3.6.3.10]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Collecting duct acid secretion
Gastric acid secretion
Drug target
Omeprazole: 
Pantoprazole: 
Lansoprazole: 
Rabeprazole: 
Esomeprazole: 
Dexlansoprazole: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    496 (ATP4B)
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    496 (ATP4B)
  Excretory system
   04966 Collecting duct acid secretion
    496 (ATP4B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.10  H+/K+-exchanging ATPase
     496 (ATP4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q34
AA seq 291 aa AA seqDB search
MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLY
VLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGY
SPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFI
IKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPH
YSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctgcaggagaagaagacgtgtggccagcgcatggaggagttccagcgttac
tgctggaacccggacacggggcagatgctgggccgcaccctgtcccggtgggtgtggatc
agcctgtactacgtggccttctacgtggtgatgactgggctcttcgccctgtgcctctat
gtgctgatgcagacagtggacccgtacacaccggactaccaagaccagctacggtcacca
ggggtaaccttaaggccggatgtttacggggagaaaggcctggaaattgtctacaacgtc
tctgataacagaacctgggcagacctcacacagactctccacgccttcctagcaggctac
tctccagcagcccaggaggacagcatcaactgcacctccgagcagtacttcttccaggag
agtttccgcgctcccaaccacaccaagttctcctgcaagttcacggcagatatgctgcag
aactgctcaggcctggcggatcccaacttcggctttgaagaaggaaagccatgttttatt
attaaaatgaacaggatcgtcaagttcctccccagcaacggctcggcccccagagtggac
tgcgccttcctggaccagccccgcgagctcggccagccgctgcaggtcaagtactaccct
cccaacggcaccttcagtctgcactacttcccttattacgggaagaaagcccagccccac
tacagcaaccccctggtggcagcgaagctcctcaacatccccaggaacgctgaggtcgcc
atcgtgtgcaaggtcatggcggagcacgtgaccttcaacaatccccacgacccgtatgaa
gggaaagtggagttcaaactcaagattgagaagtga

DBGET integrated database retrieval system