KEGG   Homo sapiens (human): 4973Help
Entry
4973              CDS       T01001                                 

Gene name
OLR1, CLEC8A, LOX1, LOXIN, SCARE1, SLOX1
Definition
oxidized low density lipoprotein (lectin-like) receptor 1
Orthology
K08763  
oxidised low-density lipoprotein receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    4973 (OLR1)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    4973 (OLR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13.2-p12.3
AA seq 181 aa AA seqDB search
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQL
SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQ
MELHHQNLNLQETLKRVANCSGLHPASNFLFQFSILDGAVSEEPQLPMALGGRFSFDAPL
I
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgacttttgatgacctaaagatccagactgtgaaggaccagcctgatgagaagtcaaat
ggaaaaaaagctaaaggtcttcagtttctttactctccatggtggtgcctggctgctgcg
actctaggggtcctttgcctgggattagtagtgaccattatggtgctgggcatgcaatta
tcccaggtgtctgacctcctaacacaagagcaagcaaacctaactcaccagaaaaagaaa
ctggagggacagatctcagcccggcaacaagcagaagaagcttcacaggagtcagaaaac
gaactcaaggaaatgatagaaacccttgctcggaagctgaatgagaaatccaaagagcaa
atggaacttcaccaccagaatctgaatctccaagaaacactgaagagagtagcaaattgt
tcaggacttcatccagcaagcaatttcctattccagttttccattctggatggggctgtc
tcggaggaaccccagctacccatggctctgggaggacggttctcctttgatgccccactt
atttag

DBGET integrated database retrieval system