KEGG   Homo sapiens (human): 4973Help
Entry
4973              CDS       T01001                                 

Gene name
OLR1, CLEC8A, LOX1, LOXIN, SCARE1, SLOX1
Definition
(RefSeq) oxidized low density lipoprotein receptor 1
  KO
K08763  
oxidised low-density lipoprotein receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    4973 (OLR1)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    4973 (OLR1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    4973 (OLR1)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   4973 (OLR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13.2-p12.3
AA seq 273 aa AA seqDB search
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQL
SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQ
MELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLL
KINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPS
GTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgacttttgatgacctaaagatccagactgtgaaggaccagcctgatgagaagtcaaat
ggaaaaaaagctaaaggtcttcagtttctttactctccatggtggtgcctggctgctgcg
actctaggggtcctttgcctgggattagtagtgaccattatggtgctgggcatgcaatta
tcccaggtgtctgacctcctaacacaagagcaagcaaacctaactcaccagaaaaagaaa
ctggagggacagatctcagcccggcaacaagcagaagaagcttcacaggagtcagaaaac
gaactcaaggaaatgatagaaacccttgctcggaagctgaatgagaaatccaaagagcaa
atggaacttcaccaccagaatctgaatctccaagaaacactgaagagagtagcaaattgt
tcagctccttgtccgcaagactggatctggcatggagaaaactgttacctattttcctcg
ggctcatttaactgggaaaagagccaagagaagtgcttgtctttggatgccaagttgctg
aaaattaatagcacagctgatctggacttcatccagcaagcaatttcctattccagtttt
ccattctggatggggctgtctcggaggaaccccagctacccatggctctgggaggacggt
tctcctttgatgccccacttatttagagtccgaggcgctgtctcccagacatacccttca
ggtacctgtgcatatatacaacgaggagctgtttatgcggaaaactgcattttagctgcc
ttcagtatatgtcagaagaaggcaaacctaagagcacagtga

DBGET integrated database retrieval system