KEGG   Homo sapiens (human): 498Help
Entry
498               CDS       T01001                                 

Gene name
ATP5A1, ATP5A, ATP5AL2, ATPM, COXPD22, HEL-S-123m, MC5DN4, MOM2, OMR, ORM, hATP1
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle
  KO
K02132  
F-type H+-transporting ATPase subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
F-type ATPase, eukaryotes
Disease
H01369  
ATP synthase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    498 (ATP5A1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    498 (ATP5A1)
   05012 Parkinson's disease
    498 (ATP5A1)
   05016 Huntington's disease
    498 (ATP5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q21
AA seq 553 aa AA seqDB search
MLSVRVAAAVVRALPRRAGLVSRNALGSSFIAARNFHASNTHLQKTGTAEMSSILEERIL
GADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFG
NDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGII
PRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKK
KLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFG
GGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSA
AQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMA
IEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKL
KEIVTNFLAGFEA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccgtgcgcgttgctgcggccgtggtccgcgcccttcctcggcgggccggactg
gtctccagaaatgctttgggttcatctttcattgctgcaaggaacttccatgcctctaac
actcatcttcaaaagactgggactgctgagatgtcctctattcttgaagagcgtattctt
ggagctgatacctctgttgatcttgaagaaactgggcgtgtcttaagtattggtgatggt
attgcccgcgtacatgggctgaggaatgttcaagcagaagaaatggtagagttttcttca
ggcttaaagggtatgtccttgaacttggaacctgacaatgttggtgttgtcgtgtttgga
aatgataaactaattaaggaaggagatatagtgaagaggacaggagccattgtggacgtt
ccagttggtgaggagctgttgggtcgtgtagttgatgcccttggtaatgctattgatgga
aagggtccaattggttccaagacgcgtaggcgagttggtctgaaagcccccggtatcatt
cctcgaatttcagtgcgggaaccaatgcagactggcattaaggctgtggatagcttggtg
ccaattggtcgtggtcagcgtgaactgattattggtgaccgacagactgggaaaacctca
attgctattgacacaatcattaaccagaaacgtttcaatgatggatctgatgaaaagaag
aagctgtactgtatttatgttgctattggtcaaaagagatccactgttgcccagttggtg
aagagacttacagatgcagatgccatgaagtacaccattgtggtgtcggctacggcctcg
gatgctgccccacttcagtacctggctccttactctggctgttccatgggagagtatttt
agagacaatggcaaacatgctttgatcatctatgacgacttatccaaacaggctgttgct
taccgtcagatgtctctgttgctccgccgaccccctggtcgtgaggcctatcctggtgat
gtgttctacctacactcccggttgctggagagagcagccaaaatgaacgatgcttttggt
ggtggctccttgactgctttgccagtcatagaaacacaggctggtgatgtgtctgcttac
attccaacaaatgtcatttccatcactgacggacagatcttcttggaaacagaattgttc
tacaaaggtatccgccctgcaattaacgttggtctgtctgtatctcgtgtcggatccgct
gcccaaaccagggctatgaagcaggtagcaggtaccatgaagctggaattggctcagtat
cgtgaggttgctgcttttgcccagttcggttctgacctcgatgctgccactcaacaactt
ttgagtcgtggcgtgcgtctaactgagttgctgaagcaaggacagtattctcccatggct
attgaagaacaagtggctgttatctatgcgggtgtaaggggatatcttgataaactggag
cccagcaagattacaaagtttgagaatgctttcttgtctcatgtcgtcagccagcaccaa
gccttgttgggcactatcagggctgatggaaagatctcagaacaatcagatgcaaagctg
aaagagattgtaacaaatttcttggctggatttgaagcttaa

DBGET integrated database retrieval system