KEGG   Homo sapiens (human): 498Help
Entry
498               CDS       T01001                                 

Gene name
ATP5A1, ATP5A, ATP5AL2, ATPM, HEL-S-123m, MC5DN4, MOM2, OMR, ORM, hATP1
Definition
ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle
Orthology
K02132  
F-type H+-transporting ATPase subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
F-type ATPase, eukaryotes
Disease
H01369  
ATP synthase deficiency
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q21
AA seq 503 aa AA seqDB search
MSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLE
PDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRR
RVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQK
RFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP
YSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLE
RAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINV
GLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTEL
LKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADG
KISEQSDAKLKEIVTNFLAGFEA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctattcttgaagagcgtattcttggagctgatacctctgttgatcttgaagaa
actgggcgtgtcttaagtattggtgatggtattgcccgcgtacatgggctgaggaatgtt
caagcagaagaaatggtagagttttcttcaggcttaaagggtatgtccttgaacttggaa
cctgacaatgttggtgttgtcgtgtttggaaatgataaactaattaaggaaggagatata
gtgaagaggacaggagccattgtggacgttccagttggtgaggagctgttgggtcgtgta
gttgatgcccttggtaatgctattgatggaaagggtccaattggttccaagacgcgtagg
cgagttggtctgaaagcccccggtatcattcctcgaatttcagtgcgggaaccaatgcag
actggcattaaggctgtggatagcttggtgccaattggtcgtggtcagcgtgaactgatt
attggtgaccgacagactgggaaaacctcaattgctattgacacaatcattaaccagaaa
cgtttcaatgatggatctgatgaaaagaagaagctgtactgtatttatgttgctattggt
caaaagagatccactgttgcccagttggtgaagagacttacagatgcagatgccatgaag
tacaccattgtggtgtcggctacggcctcggatgctgccccacttcagtacctggctcct
tactctggctgttccatgggagagtattttagagacaatggcaaacatgctttgatcatc
tatgacgacttatccaaacaggctgttgcttaccgtcagatgtctctgttgctccgccga
ccccctggtcgtgaggcctatcctggtgatgtgttctacctacactcccggttgctggag
agagcagccaaaatgaacgatgcttttggtggtggctccttgactgctttgccagtcata
gaaacacaggctggtgatgtgtctgcttacattccaacaaatgtcatttccatcactgac
ggacagatcttcttggaaacagaattgttctacaaaggtatccgccctgcaattaacgtt
ggtctgtctgtatctcgtgtcggatccgctgcccaaaccagggctatgaagcaggtagca
ggtaccatgaagctggaattggctcagtatcgtgaggttgctgcttttgcccagttcggt
tctgacctcgatgctgccactcaacaacttttgagtcgtggcgtgcgtctaactgagttg
ctgaagcaaggacagtattctcccatggctattgaagaacaagtggctgttatctatgcg
ggtgtaaggggatatcttgataaactggagcccagcaagattacaaagtttgagaatgct
ttcttgtctcatgtcgtcagccagcaccaagccttgttgggcactatcagggctgatgga
aagatctcagaacaatcagatgcaaagctgaaagagattgtaacaaatttcttggctgga
tttgaagcttaa

DBGET integrated database retrieval system