KEGG   Homo sapiens (human): 4982Help
Entry
4982              CDS       T01001                                 

Gene name
TNFRSF11B, OCIF, OPG, TR1
Definition
tumor necrosis factor receptor superfamily, member 11b
Orthology
K05148  
tumor necrosis factor receptor superfamily member 11B
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Osteoclast differentiation
Disease
H00437  
Paget's disease of bone and related disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4982 (TNFRSF11B)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    4982 (TNFRSF11B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q24
AA seq 401 aa AA seqDB search
MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKT
VCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLK
HRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNAT
HDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERI
KRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLME
SLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKT
VTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacttgctgtgctgcgcgctcgtgtttctggacatctccattaagtggaccacc
caggaaacgtttcctccaaagtaccttcattatgacgaagaaacctctcatcagctgttg
tgtgacaaatgtcctcctggtacctacctaaaacaacactgtacagcaaagtggaagacc
gtgtgcgccccttgccctgaccactactacacagacagctggcacaccagtgacgagtgt
ctatactgcagccccgtgtgcaaggagctgcagtacgtcaagcaggagtgcaatcgcacc
cacaaccgcgtgtgcgaatgcaaggaagggcgctaccttgagatagagttctgcttgaaa
cataggagctgccctcctggatttggagtggtgcaagctggaaccccagagcgaaataca
gtttgcaaaagatgtccagatgggttcttctcaaatgagacgtcatctaaagcaccctgt
agaaaacacacaaattgcagtgtctttggtctcctgctaactcagaaaggaaatgcaaca
cacgacaacatatgttccggaaacagtgaatcaactcaaaaatgtggaatagatgttacc
ctgtgtgaggaggcattcttcaggtttgctgttcctacaaagtttacgcctaactggctt
agtgtcttggtagacaatttgcctggcaccaaagtaaacgcagagagtgtagagaggata
aaacggcaacacagctcacaagaacagactttccagctgctgaagttatggaaacatcaa
aacaaagaccaagatatagtcaagaagatcatccaagatattgacctctgtgaaaacagc
gtgcagcggcacattggacatgctaacctcaccttcgagcagcttcgtagcttgatggaa
agcttaccgggaaagaaagtgggagcagaagacattgaaaaaacaataaaggcatgcaaa
cccagtgaccagatcctgaagctgctcagtttgtggcgaataaaaaatggcgaccaagac
accttgaagggcctaatgcacgcactaaagcactcaaagacgtaccactttcccaaaact
gtcactcagagtctaaagaagaccatcaggttccttcacagcttcacaatgtacaaattg
tatcagaagttatttttagaaatgataggtaaccaggtccaatcagtaaaaataagctgc
ttataa

DBGET integrated database retrieval system