KEGG   Homo sapiens (human): 4985Help
Entry
4985              CDS       T01001                                 

Gene name
OPRD1, OPRD
Definition
opioid receptor, delta 1
Orthology
K04213  
delta-type opioid receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Methylnaltrexone bromide: 
Dezocine: 
Meptazinol: 
Naltrexone: 
Naloxone: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.1-p34.3
AA seq 372 aa AA seqDB search
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggccccctccgccggcgccgagctgcagcccccgctcttcgccaacgcctcg
gacgcctaccctagcgcctgccccagcgctggcgccaatgcgtcggggccgccaggcgcg
cggagcgcctcgtccctcgccctggcaatcgccatcaccgcgctctactcggccgtgtgc
gccgtggggctgctgggcaacgtgcttgtcatgttcggcatcgtccggtacactaagatg
aagacggccaccaacatctacatcttcaacctggccttagccgatgcgctggccaccagc
acgctgcctttccagagtgccaagtacctgatggagacgtggcccttcggcgagctgctc
tgcaaggctgtgctctccatcgactactacaatatgttcaccagcatcttcacgctcacc
atgatgagtgttgaccgctacatcgctgtctgccaccctgtcaaggccctggacttccgc
acgcctgccaaggccaagctgatcaacatctgtatctgggtcctggcctcaggcgttggc
gtgcccatcatggtcatggctgtgacccgtccccgggacggggcagtggtgtgcatgctc
cagttccccagccccagctggtactgggacacggtgaccaagatctgcgtgttcctcttc
gccttcgtggtgcccatcctcatcatcaccgtgtgctatggcctcatgctgctgcgcctg
cgcagtgtgcgcctgctgtcgggctccaaggagaaggaccgcagcctgcggcgcatcacg
cgcatggtgctggtggttgtgggcgccttcgtggtgtgttgggcgcccatccacatcttc
gtcatcgtctggacgctggtggacatcgaccggcgcgacccgctggtggtggctgcgctg
cacctgtgcatcgcgctgggctacgccaatagcagcctcaaccccgtgctctacgctttc
ctcgacgagaacttcaagcgctgcttccgccagctctgccgcaagccctgcggccgccca
gaccccagcagcttcagccgcgcccgcgaagccacggcccgcgagcgtgtcaccgcctgc
accccgtccgatggtcccggcggtggcgctgccgcctga

DBGET integrated database retrieval system