KEGG   Homo sapiens (human): 4985Help
Entry
4985              CDS       T01001                                 

Gene name
OPRD1, OPRD
Definition
(RefSeq) opioid receptor delta 1
  KO
K04213  delta-type opioid receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H01703  Eating Disorders
Drug target
Dezocine: D00838
Eluxadoline: D10403
Etorphine: D07937
Levallorphan tartrate: D02238
Loperamide (DG00092): D00729 D08144
Loperamide oxide (DG00092): D07113
Meptazinol (DG00825): D04924 D08182
Metkephamid acetate: D05007
Nalmefene (DG00998): D10812
Naloxone (DG01155): D01340 D08249
Naltrexone (DG00997): D02095 D05113
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    4985 (OPRD1)
   04022 cGMP - PKG signaling pathway
    4985 (OPRD1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4985 (OPRD1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Opioid
    4985 (OPRD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 4985
NCBI-ProteinID: NP_000902
OMIM: 165195
HGNC: 8153
Ensembl: ENSG00000116329
Vega: OTTHUMG00000003646
Pharos: P41143(Tclin)
UniProt: P41143
Position
1p35.3
AA seq 372 aa AA seqDB search
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggccccctccgccggcgccgagctgcagcccccgctcttcgccaacgcctcg
gacgcctaccctagcgcctgccccagcgctggcgccaatgcgtcggggccgccaggcgcg
cggagcgcctcgtccctcgccctggcaatcgccatcaccgcgctctactcggccgtgtgc
gccgtggggctgctgggcaacgtgcttgtcatgttcggcatcgtccggtacactaagatg
aagacggccaccaacatctacatcttcaacctggccttagccgatgcgctggccaccagc
acgctgcctttccagagtgccaagtacctgatggagacgtggcccttcggcgagctgctc
tgcaaggctgtgctctccatcgactactacaatatgttcaccagcatcttcacgctcacc
atgatgagtgttgaccgctacatcgctgtctgccaccctgtcaaggccctggacttccgc
acgcctgccaaggccaagctgatcaacatctgtatctgggtcctggcctcaggcgttggc
gtgcccatcatggtcatggctgtgacccgtccccgggacggggcagtggtgtgcatgctc
cagttccccagccccagctggtactgggacacggtgaccaagatctgcgtgttcctcttc
gccttcgtggtgcccatcctcatcatcaccgtgtgctatggcctcatgctgctgcgcctg
cgcagtgtgcgcctgctgtcgggctccaaggagaaggaccgcagcctgcggcgcatcacg
cgcatggtgctggtggttgtgggcgccttcgtggtgtgttgggcgcccatccacatcttc
gtcatcgtctggacgctggtggacatcgaccggcgcgacccgctggtggtggctgcgctg
cacctgtgcatcgcgctgggctacgccaatagcagcctcaaccccgtgctctacgctttc
ctcgacgagaacttcaagcgctgcttccgccagctctgccgcaagccctgcggccgccca
gaccccagcagcttcagccgcgcccgcgaagccacggcccgcgagcgtgtcaccgcctgc
accccgtccgatggtcccggcggtggcgctgccgcctga

DBGET integrated database retrieval system