KEGG   Homo sapiens (human): 4986Help
Entry
4986              CDS       T01001                                 

Gene name
OPRK1, K-OR-1, KOR, KOR-1, OPRK
Definition
opioid receptor, kappa 1
Orthology
K04214  
kappa-type opioid receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Methylnaltrexone bromide: 
Pentazocine: 
Buprenorphine: 
Butorphanol: 
Nalbuphine: 
Dezocine: 
Meptazinol: 
Naltrexone: 
Nalmefene: 
Naloxone: 
Nalfurafine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4986 (OPRK1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Opioid
    4986 (OPRK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q11.2
AA seq 380 aa AA seqDB search
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggactccccgatccagatcttccgcggggagccgggccctacctgcgccccgagcgcc
tgcctgccccccaacagcagcgcctggtttcccggctgggccgagcccgacagcaacggc
agcgccggctcggaggacgcgcagctggagcccgcgcacatctccccggccatcccggtc
atcatcacggcggtctactccgtagtgttcgtcgtgggcttggtgggcaactcgctggtc
atgttcgtgatcatccgatacacaaagatgaagacagcaaccaacatttacatatttaac
ctggctttggcagatgctttagttactacaaccatgccctttcagagtacggtctacttg
atgaattcctggccttttggggatgtgctgtgcaagatagtaatttccattgattactac
aacatgttcaccagcatcttcaccttgaccatgatgagcgtggaccgctacattgccgtg
tgccaccccgtgaaggctttggacttccgcacacccttgaaggcaaagatcatcaatatc
tgcatctggctgctgtcgtcatctgttggcatctctgcaatagtccttggaggcaccaaa
gtcagggaagacgtcgatgtcattgagtgctccttgcagttcccagatgatgactactcc
tggtgggacctcttcatgaagatctgcgtcttcatctttgccttcgtgatccctgtcctc
atcatcatcgtctgctacaccctgatgatcctgcgtctcaagagcgtccggctcctttct
ggctcccgagagaaagatcgcaacctgcgtaggatcaccagactggtcctggtggtggtg
gcagtcttcgtcgtctgctggactcccattcacatattcatcctggtggaggctctgggg
agcacctcccacagcacagctgctctctccagctattacttctgcatcgccttaggctat
accaacagtagcctgaatcccattctctacgcctttcttgatgaaaacttcaagcggtgt
ttccgggacttctgctttccactgaagatgaggatggagcggcagagcactagcagagtc
cgaaatacagttcaggatcctgcttacctgagggacatcgatgggatgaataaaccagta
tga

DBGET integrated database retrieval system