KEGG   Homo sapiens (human): 4986Help
Entry
4986              CDS       T01001                                 

Gene name
OPRK1, K-OR-1, KOR, KOR-1, OPRK
Definition
(RefSeq) opioid receptor kappa 1
  KO
K04214  
kappa-type opioid receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Buprenorphine (DG00820): 
Butorphanol (DG00821): 
Cyclazocine: 
Dezocine: 
Diprenorphine (DG01273): 
Enadoline hydrochloride: 
Eptazocine (DG01340): 
Etorphine: 
Ketazocine: 
Levallorphan tartrate: 
Meptazinol (DG00825): 
Methylnaltrexone bromide: 
Nalbuphine (DG00822): 
Nalfurafine: 
Nalmefene (DG00998): 
Naloxone (DG01155): 
Naltrexone (DG00997): 
Pentazocine (DG00819): 
Quadazocine mesylate: 
Spiradoline mesylate: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4986 (OPRK1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Opioid
    4986 (OPRK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P41145(Tclin)
UniProt: 
Position
8q11.23
AA seq 380 aa AA seqDB search
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggactccccgatccagatcttccgcggggagccgggccctacctgcgccccgagcgcc
tgcctgccccccaacagcagcgcctggtttcccggctgggccgagcccgacagcaacggc
agcgccggctcggaggacgcgcagctggagcccgcgcacatctccccggccatcccggtc
atcatcacggcggtctactccgtagtgttcgtcgtgggcttggtgggcaactcgctggtc
atgttcgtgatcatccgatacacaaagatgaagacagcaaccaacatttacatatttaac
ctggctttggcagatgctttagttactacaaccatgccctttcagagtacggtctacttg
atgaattcctggccttttggggatgtgctgtgcaagatagtaatttccattgattactac
aacatgttcaccagcatcttcaccttgaccatgatgagcgtggaccgctacattgccgtg
tgccaccccgtgaaggctttggacttccgcacacccttgaaggcaaagatcatcaatatc
tgcatctggctgctgtcgtcatctgttggcatctctgcaatagtccttggaggcaccaaa
gtcagggaagacgtcgatgtcattgagtgctccttgcagttcccagatgatgactactcc
tggtgggacctcttcatgaagatctgcgtcttcatctttgccttcgtgatccctgtcctc
atcatcatcgtctgctacaccctgatgatcctgcgtctcaagagcgtccggctcctttct
ggctcccgagagaaagatcgcaacctgcgtaggatcaccagactggtcctggtggtggtg
gcagtcttcgtcgtctgctggactcccattcacatattcatcctggtggaggctctgggg
agcacctcccacagcacagctgctctctccagctattacttctgcatcgccttaggctat
accaacagtagcctgaatcccattctctacgcctttcttgatgaaaacttcaagcggtgt
ttccgggacttctgctttccactgaagatgaggatggagcggcagagcactagcagagtc
cgaaatacagttcaggatcctgcttacctgagggacatcgatgggatgaataaaccagta
tga

DBGET integrated database retrieval system