KEGG   Homo sapiens (human): 49861Help
Entry
49861             CDS       T01001                                 

Gene name
CLDN20
Definition
claudin 20
Orthology
K06087  
claudin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q25
AA seq 219 aa AA seqDB search
MASAGLQLLAFILALSGVSGVLTATLLPNWKVNVDVDSNIITAIVQLHGLWMDCTWYSTG
MFSCALKHSILSLPIHVQAARATMVLACVLSALGICTSTVGMKCTRLGGDRETKSHASFA
GGVCFMSAGISSLISTVWYTKEIIANFLDLTVPESNKHEPGGAIYIGFISAMLLFISGMI
FCTSCIKRNPEARLDPPTQQPISNTQLENNSTHNLKDYV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagcaggactccagctccttgctttcatcctggccttatctggggtctctgga
gtgctcacagccactctgctgcccaactggaaggtgaatgtggatgtggactccaacatc
ataacagccattgtacagctgcacgggctctggatggactgtacgtggtacagcactggg
atgttcagctgtgccctgaaacactccattctgtccctccccatccacgtgcaggctgcg
agagccaccatggtcctggcgtgtgttctgtctgctttggggatctgcacttccacagta
ggaatgaaatgtactcgcttaggaggggacagagaaaccaagagccatgcttcctttgct
ggaggagtctgtttcatgtctgcaggaatctctagtttaatctcgacagtgtggtacaca
aaggagatcatagcaaactttctggatctgacagttccagaaagcaacaaacatgaacct
ggaggagctatctatatcggattcatttctgcaatgctgttgtttatctctggcatgatt
ttctgcacctcctgtataaaaaggaatccagaagctagactcgacccacccacacagcag
cctatctctaacacacagctcgagaacaattccacacacaatctgaaggattatgtgtaa

DBGET integrated database retrieval system