KEGG   Homo sapiens (human): 4987Help
Entry
4987              CDS       T01001                                 

Gene name
OPRL1, KOR-3, NOCIR, NOP, NOPr, OOR, ORL1
Definition
(RefSeq) opioid related nociceptin receptor 1
  KO
K04216  
nociceptin receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Cebranopadol (DG02351): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4987 (OPRL1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Opioid
    4987 (OPRL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P41146(Tchem)
UniProt: 
Position
20q13.33
AA seq 370 aa AA seqDB search
MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggagcccctcttccccgcgccgttctgggaggttatctacggcagccaccttcagggc
aacctgtccctcctgagccccaaccacagtctgctgcccccgcatctgctgctcaatgcc
agccacggcgccttcctgcccctcgggctcaaggtcaccatcgtggggctctacctggcc
gtgtgtgtcggagggctcctggggaactgccttgtcatgtacgtcatcctcaggcacacc
aaaatgaagacagccaccaatatttacatctttaacctggccctggccgacactctggtc
ctgctgacgctgcccttccagggcacggacatcctcctgggcttctggccgtttgggaat
gcgctgtgcaagacagtcattgccattgactactacaacatgttcaccagcaccttcacc
ctaactgccatgagtgtggatcgctatgtagccatctgccaccccatccgtgccctcgac
gtccgcacgtccagcaaagcccaggctgtcaatgtggccatctgggccctggcctctgtt
gtcggtgttcccgttgccatcatgggctcggcacaggtcgaggatgaagagatcgagtgc
ctggtggagatccctacccctcaggattactggggcccggtgtttgccatctgcatcttc
ctcttctccttcatcgtccccgtgctcgtcatctctgtctgctacagcctcatgatccgg
cggctccgtggagtccgcctgctctcgggctcccgagagaaggaccggaacctgcggcgc
atcactcggctggtgctggtggtagtggctgtgttcgtgggctgctggacgcctgtccag
gtcttcgtgctggcccaagggctgggggttcagccgagcagcgagactgccgtggccatt
ctgcgcttctgcacggccctgggctacgtcaacagctgcctcaaccccatcctctacgcc
ttcctggatgagaacttcaaggcctgcttccgcaagttctgctgtgcatctgccctgcgc
cgggacgtgcaggtgtctgaccgcgtgcgcagcattgccaaggacgtggccctggcctgc
aagacctctgagacggtaccgcggcccgcatga

DBGET integrated database retrieval system