KEGG   Homo sapiens (human): 4992Help
Entry
4992              CDS       T01001                                 

Gene name
OR1F1, OLFMF, OR16-36, OR16-37, OR16-88, OR16-89, OR16-90, OR1F10, OR1F13P, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, OR3-145, ORL1023
Definition
olfactory receptor, family 1, subfamily F, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 312 aa AA seqDB search
MSGTNQSSVSEFLLLGLSRQPQQQHLLFVFFLSMYLATVLGNLLIILSVSIDSCLHTPMY
FFLSNLSFVDICFSFTTVPKMLANHILETQTISFCGCLTQMYFVFMFVDMDNFLLAVMAY
DHFVAVCHPLHYTAKMTHQLCALLVAGLWVVANLNVLLHTLLMAPLSFCADNAITHFFCD
VTPLLKLSCSDTHLNEVIILSEGALVMITPFLCILASYMHITCTVLKVPSTKGRWKAFST
CGSHLAVVLLFYSTIIAVYFNPLSSHSAEKDTMATVLYTVVTPMLNPFIYSLRNRYLKGA
LKKVVGRVVFSV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggacaaaccagtcgagtgtctccgagttcctcctcctgggactctccaggcag
ccccagcagcagcatctcctctttgtgttcttcctcagcatgtacctggccactgtcctg
gggaacctgctcatcatcctgtccgtaagcatagactcctgcctgcacacccccatgtac
ttcttcctcagcaacctgtcttttgtggacatctgcttctccttcaccaccgtccccaag
atgctggccaatcacatactcgagactcagaccatctccttctgtggctgtctcacacag
atgtatttcgttttcatgttcgtggacatggacaatttcctcctagctgtgatggcctat
gaccactttgtcgccgtgtgccaccccttacattacacagcaaagatgacccatcagctc
tgtgccctgctggttgctggattatgggtggttgccaacctgaatgtccttctgcacacc
ctgctgatggctccactctcattctgtgcagacaatgccatcactcacttcttctgcgat
gtgactcccctactgaaactctcctgctcagacacacacctcaatgaggtcataatcctt
agtgagggtgccctggtcatgatcaccccatttctttgcatcctggcttcttatatgcac
atcacctgcactgtcctgaaggtcccatccacaaagggaaggtggaaagccttctccacc
tgtggttctcacctggctgtggttctcctcttctacagcaccatcattgctgtgtatttt
aaccctctgtcctcccactcagctgagaaagacactatggctactgtgttgtatacagta
gtgactcccatgctaaaccctttcatctacagcctgaggaacaggtacttgaaaggggct
ctgaaaaaagtagttggcagggtggtgttttctgtctga

DBGET integrated database retrieval system