KEGG   Homo sapiens (human): 4993Help
Entry
4993              CDS       T01001                                 

Gene name
OR2C1, OLFmf3, OR2C2P
Definition
(RefSeq) olfactory receptor family 2 subfamily C member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    4993 (OR2C1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    4993 (OR2C1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 4993
NCBI-ProteinID: NP_036500
HGNC: 8242
Ensembl: ENSG00000168158
Vega: OTTHUMG00000090505
Pharos: O95371(Tdark)
UniProt: O95371
Position
16p13.3
AA seq 312 aa AA seqDB search
MDGVNDSSLQGFVLMGISDHPQLEMIFFIAILFSYLLTLLGNSTIILLSRLEARLHTPMY
FFLSNLSSLDLAFATSSVPQMLINLWGPGKTISYGGCITQLYVFLWLGATECILLVVMAF
DRYVAVCRPLRYTAIMNPQLCWLLAVIACLGGLGNSVIQSTFTLQLPLCGHRRVEGFLCE
VPAMIKLACGDTSLNQAVLNGVCTFFTAVPLSIIVISYCLIAQAVLKIRSAEGRRKAFNT
CLSHLLVVFLFYGSASYGYLLPAKNSKQDQGKFISLFYSLVTPMVNPLIYTLRNMEVKGA
LRRLLGKGREVG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggacggggtgaatgatagctccttgcagggctttgttctgatgggcatatcagaccat
ccccagctggagatgatcttttttatagccatcctcttctcctatttgctgaccctactt
gggaactcaaccatcatcttgctttcccgcctggaggcccggctccatacacccatgtac
ttcttcctcagcaacctctcctccttggaccttgctttcgctactagttcagtcccccaa
atgctgatcaatttatggggaccaggcaagaccatcagctatggtggctgcataacccag
ctctatgtcttcctttggctgggggccaccgagtgcatcctgctggtggtgatggcattt
gaccgctacgtggcagtgtgccggcccctccgctacaccgccatcatgaacccccagctc
tgctggctgctggctgtgattgcctgcctgggtggcttgggcaactctgtgatccagtca
acattcactctgcagctcccattgtgtgggcaccggagggtggagggattcctctgcgag
gtgcctgccatgatcaaactggcctgtggcgacacaagtctcaaccaggctgtgctcaat
ggtgtctgcaccttcttcactgcagtcccactaagcatcatcgtgatctcctactgcctc
attgctcaggcagtgctgaaaatccgctctgcagaggggaggcgaaaggcgttcaatacg
tgcctctcccatctgctggtggtgttcctcttctatggctcagccagctatgggtatctg
cttccggccaagaacagcaaacaggaccagggcaagttcatttccctgttctactcgttg
gtcacacccatggtgaatcccctcatctacacgctgcggaacatggaagtgaagggcgca
ctgaggaggttgctggggaaaggaagagaagttggctga

DBGET integrated database retrieval system