KEGG   Homo sapiens (human): 4998Help
Entry
4998              CDS       T01001                                 

Gene name
ORC1, HSORC1, ORC1L, PARC1
Definition
origin recognition complex, subunit 1
Orthology
K02603  
origin recognition complex subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Module
Origin recognition complex
Disease
H00464  
Patella dysplasias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    4998 (ORC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p32
AA seq 861 aa AA seqDB search
MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDD
ENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQEIFWYDYPAC
DSNINAETIIGLVRVIPLAPKDVVPTNLKNEKTLFVKLSWNEKKFRPLSSELFAELNKPQ
ESAAKCQKPVRAKSKSAESPSWTPAEHVAKRIESRHSASKSRQTPTHPLTPRARKRLELG
NLGNPQMSQQTSCASLDSPGRIKRKVAFSEITSPSKRSQPDKLQTLSPALKAPEKTRETG
LSYTEDDKKASPEHRIILRTRIAASKTIDIREERTLTPISGGQRSSVVPSVILKPENIKK
RDAKEAKAQNEATSTPHRIRRKSSVLTMNRIRQQLRFLGNSKSDQEEKEILPAAEISDSS
SDEEEASTPPLPRRAPRTVSRNLRSSLKSSLHTLTKVPKKSLKPRTPRCAAPQIRSRSLA
AQEPASVLEEARLRLHVSAVPESLPCREQEFQDIYNFVESKLLDHTGGCMYISGVPGTGK
TATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAEL
LAKQFCTRGSPQETTVLLVDELDLLWTHKQDIMYNLFDWPTHKEARLVVLAIANTMDLPE
RIMMNRVSSRLGLTRMCFQPYTYSQLQQILRSRLKHLKAFEDDAIQLVARKVAALSGDAR
RCLDICRRATEICEFSQQKPDSPGLVTIAHSMEAVDEMFSSSYITAIKNSSVLEQSFLRA
ILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRND
LLLRVRLNVSQDDVLYALKDE
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atggcacactaccccacaaggctgaagaccagaaaaacttattcatgggttggcaggccc
ttgttggatcgaaaactgcactaccaaacctatagagaaatgtgtgtgaaaacagaaggt
tgttccaccgagattcacatccagattggacagtttgtgttgattgaaggggatgatgat
gaaaacccgtatgttgctaaattgcttgagttgttcgaagatgactctgatcctcctcct
aagaaacgtgctcgagtacagtggtttgtccgattctgtgaagtccctgcctgtaaacgg
catttgttgggccggaagcctggtgcacaggaaatattctggtatgattacccggcctgt
gacagcaacattaatgcggagaccatcattggccttgttcgggtgatacctttagcccca
aaggatgtggtaccgacgaatctgaaaaatgagaagacactctttgtgaaactatcctgg
aatgagaagaaattcaggccactttcctcagaactatttgcggagttgaataaaccacaa
gagagtgcagccaagtgccagaaacccgtgagagccaagagtaagagtgcagagagccct
tcttggaccccagcagaacatgtggccaaaaggattgaatcaaggcactccgcctccaaa
tctcgccaaactcctacccatcctcttaccccaagagccagaaagaggctggagcttggc
aacttaggtaaccctcagatgtcccagcagacttcatgtgcctccttggattctccagga
agaataaaacggaaagtggccttctcggagatcacctcaccttctaagagatctcagcct
gataaacttcaaaccttgtctccagctctgaaagccccagagaaaaccagagagactgga
ctctcttatactgaggatgacaagaaggcttcacctgaacatcgcataatcctgagaacc
cgaattgcagcttcgaaaaccatagacattagagaggagagaacacttacccctatcagt
gggggacagagatcttcagtggtgccatccgtgattctgaaaccagaaaacatcaaaaag
agggatgcaaaagaagcaaaagcccagaatgaagcgacctctactccccatcgtatccgc
agaaagagttctgtcttgactatgaatcggattaggcagcagcttcggtttctaggtaat
agtaaaagtgaccaagaagagaaagagattctgccagcagcagagatttcagactctagc
agtgacgaagaagaggcttccacaccgccccttccaaggagagcacccagaactgtgtcc
aggaacctgcgatcttccttgaagtcatccttacataccctcacgaaggtgccaaagaag
agtctcaagcctagaacgccacgttgtgccgctcctcagatccgtagtcgaagcctggct
gcccaggagccagccagtgtgctggaggaagcccgactgaggctgcatgtttctgctgta
cctgagtctcttccctgtcgggaacaggaattccaagacatctacaattttgtggaaagc
aaactccttgaccataccggagggtgcatgtacatctccggtgtccctgggacagggaag
actgccactgttcatgaagtgatacgctgcctgcagcaggcagcccaagccaatgatgtt
cctccctttcaatacattgaggtcaatggcatgaagctgacggagccccaccaagtctat
gtgcaaatcttgcagaagctaacaggccaaaaagcaacagccaaccatgcggcagaactg
ctggcaaagcaattctgcacccgagggtcacctcaggaaaccaccgtcctgcttgtggat
gagctcgaccttctgtggactcacaaacaagacataatgtacaatctctttgactggccc
actcataaggaggcccggcttgtggtcctggcaattgccaacacaatggacctgccagag
cgaatcatgatgaaccgggtgtccagccgactgggtcttaccaggatgtgcttccagccc
tatacatatagccagctgcagcagatcctaaggtcccggctcaagcatctaaaggccttt
gaagatgatgccatccagctggtagccaggaaggtagcagcactgtctggagatgcacga
cggtgcctggacatctgcaggcgtgccacagagatctgtgagttctcccagcagaagcct
gactcccctggcctggtcaccatagcccactcaatggaagctgtggatgagatgttttca
tcatcatacatcacggccatcaaaaattcctctgttctggaacagagcttcctgagagcc
atcctcgcagagttccgtcgatcaggactggaggaagccacgtttcaacagatatatagt
caacatgtggcactgtgcagaatggagggactgccgtaccccaccatgtcagagaccatg
gccgtgtgttctcacctgggctcctgtcgcctcctgcttgtggagcccagcaggaacgat
ctgctccttcgggtgcggctcaacgtcagccaggatgatgtgctgtatgcgctgaaagac
gagtaa

DBGET integrated database retrieval system