KEGG   Homo sapiens (human): 4999Help
Entry
4999              CDS       T01001                                 

Gene name
ORC2, ORC2L
Definition
origin recognition complex, subunit 2
Orthology
K02604  
origin recognition complex subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Module
Origin recognition complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    4999 (ORC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
2q33
AA seq 577 aa AA seqDB search
MSKPELKEDKMLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEED
DQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAKLASELAKTPQKS
VSFSLKNDPEITINVPQSSKGHSASDKVQPKNNDKSEFLSTAPRSLRKRLIVPRSHSDSE
SEYSASNSEDDEGVAQEHEEDTNAVIFSQKIQAQNRVVSAPVGKETPSKRMKRDKTSDLV
EEYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVSPSFSAELKQLNQQYEKLFHK
WMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKSVLNSITEEVL
DHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYL
IASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLTHV
LRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFR
DHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaccagaattaaaggaagacaagatgctggaggttcactttgtgggagatgat
gatgttcttaatcacattctagatagagaaggaggagctaaattgaagaaggagcgagcg
cagcttttggtcaaccccaaaaaaataataaagaagccagaatatgatttggaggaagat
gaccaggaggtcttaaaagatcagaactatgtggaaattatgggaagagatgttcaagaa
tcattgaaaaatggctctgctacaggtggtggaaataaagtttattcttttcagaataga
aaacactctgaaaagatggctaaattagcttcagaactagcaaaaacaccacaaaaaagt
gtttcattcagtttgaagaatgatcctgagattacgataaacgttcctcaaagtagcaag
ggccattctgcttcagacaaggttcaaccgaagaacaatgacaaaagtgaatttctgtca
acagcacctcgtagtctaagaaaaagattaatagttccaaggtctcattctgacagtgaa
agcgaatattctgcttccaactcagaggatgatgaaggggttgcacaggaacatgaagag
gacactaatgcagtcatattcagccaaaagattcaagctcagaatagagtagtttcagct
cctgttggcaaagaaacaccttctaagagaatgaaaagagataaaacaagtgacttagta
gaagaatattttgaagctcacagcagttcaaaagttttaacctctgatagaacactgcag
aagctaaagagagctaaactggatcagcaaactttgcgtaacttattgagcaaggtttcc
ccttccttttctgccgaacttaaacaactaaatcaacagtatgaaaaattatttcataaa
tggatgctgcaattacaccttgggttcaacattgtgctttatggtttgggttctaagaga
gatttactagaaaggtttcgaaccactatgctgcaagattccattcacgttgtcatcaat
ggcttctttcctggaatcagtgtgaaatcagtcctgaattctataacagaagaagtcctc
gatcatatgggtactttccgcagtatactggatcagctagactggatagtaaacaaattt
aaagaagattcttctttagaactcttccttctcatccacaatttggatagccagatgttg
agaggagagaagagccagcaaatcattggtcagttgtcatctttgcataacatttacctt
atagcatccattgaccacctcaatgctcctctcatgtgggatcatgcaaagcagagtctt
tttaactggctctggtatgaaactactacatacagtccttatactgaagaaacctcctat
gagaactctcttctggtaaagcagtctggatccctgccacttagctcccttactcatgtc
ttacgaagccttacccctaatgcaaggggaattttcaggctactaataaaataccagctg
gacaaccaggataacccttcttacattggcctttcttttcaagatttttaccagcagtgt
cgggaggcattcctcgtcaatagtgatctgacactccgggcccagttaactgaatttagg
gaccacaagcttataagaacaaagaagggaactgatggagtagagtatttattaattcct
gttgataatggaacattgactgatttcttggaaaaggaagaagaggaggcttga

DBGET integrated database retrieval system