KEGG   Homo sapiens (human): 4999Help
Entry
4999              CDS       T01001                                 

Gene name
ORC2, ORC2L
Definition
(RefSeq) origin recognition complex subunit 2
  KO
K02604  origin recognition complex subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Module
hsa_M00284  Origin recognition complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    4999 (ORC2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4999 (ORC2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     4999 (ORC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ORC2
Motif
Other DBs
NCBI-GeneID: 4999
NCBI-ProteinID: NP_006181
OMIM: 601182
HGNC: 8488
Ensembl: ENSG00000115942
Vega: OTTHUMG00000132783
Pharos: Q13416(Tbio)
UniProt: Q13416 A0A024R411
Structure
PDB: 

Jmol
Position
2q33.1
AA seq 577 aa AA seqDB search
MSKPELKEDKMLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEED
DQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAKLASELAKTPQKS
VSFSLKNDPEITINVPQSSKGHSASDKVQPKNNDKSEFLSTAPRSLRKRLIVPRSHSDSE
SEYSASNSEDDEGVAQEHEEDTNAVIFSQKIQAQNRVVSAPVGKETPSKRMKRDKTSDLV
EEYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVSPSFSAELKQLNQQYEKLFHK
WMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKSVLNSITEEVL
DHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYL
IASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLTHV
LRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFR
DHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaccagaattaaaggaagacaagatgctggaggttcactttgtgggagatgat
gatgttcttaatcacattctagatagagaaggaggagctaaattgaagaaggagcgagcg
cagcttttggtcaaccccaaaaaaataataaagaagccagaatatgatttggaggaagat
gaccaggaggtcttaaaagatcagaactatgtggaaattatgggaagagatgttcaagaa
tcattgaaaaatggctctgctacaggtggtggaaataaagtttattcttttcagaataga
aaacactctgaaaagatggctaaattagcttcagaactagcaaaaacaccacaaaaaagt
gtttcattcagtttgaagaatgatcctgagattacgataaacgttcctcaaagtagcaag
ggccattctgcttcagacaaggttcaaccgaagaacaatgacaaaagtgaatttctgtca
acagcacctcgtagtctaagaaaaagattaatagttccaaggtctcattctgacagtgaa
agcgaatattctgcttccaactcagaggatgatgaaggggttgcacaggaacatgaagag
gacactaatgcagtcatattcagccaaaagattcaagctcagaatagagtagtttcagct
cctgttggcaaagaaacaccttctaagagaatgaaaagagataaaacaagtgacttagta
gaagaatattttgaagctcacagcagttcaaaagttttaacctctgatagaacactgcag
aagctaaagagagctaaactggatcagcaaactttgcgtaacttattgagcaaggtttcc
ccttccttttctgccgaacttaaacaactaaatcaacagtatgaaaaattatttcataaa
tggatgctgcaattacaccttgggttcaacattgtgctttatggtttgggttctaagaga
gatttactagaaaggtttcgaaccactatgctgcaagattccattcacgttgtcatcaat
ggcttctttcctggaatcagtgtgaaatcagtcctgaattctataacagaagaagtcctc
gatcatatgggtactttccgcagtatactggatcagctagactggatagtaaacaaattt
aaagaagattcttctttagaactcttccttctcatccacaatttggatagccagatgttg
agaggagagaagagccagcaaatcattggtcagttgtcatctttgcataacatttacctt
atagcatccattgaccacctcaatgctcctctcatgtgggatcatgcaaagcagagtctt
tttaactggctctggtatgaaactactacatacagtccttatactgaagaaacctcctat
gagaactctcttctggtaaagcagtctggatccctgccacttagctcccttactcatgtc
ttacgaagccttacccctaatgcaaggggaattttcaggctactaataaaataccagctg
gacaaccaggataacccttcttacattggcctttcttttcaagatttttaccagcagtgt
cgggaggcattcctcgtcaatagtgatctgacactccgggcccagttaactgaatttagg
gaccacaagcttataagaacaaagaagggaactgatggagtagagtatttattaattcct
gttgataatggaacattgactgatttcttggaaaaggaagaagaggaggcttga

DBGET integrated database retrieval system