KEGG   Homo sapiens (human): 50Help
Entry
50                CDS       T01001                                 

Gene name
ACO2, ACONM, HEL-S-284, ICRD, OCA8, OPA9
Definition
(RefSeq) aconitase 2
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    50 (ACO2)
   00630 Glyoxylate and dicarboxylate metabolism
    50 (ACO2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     50 (ACO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-GeneID: 50
NCBI-ProteinID: NP_001089
OMIM: 100850
HGNC: 118
Ensembl: ENSG00000100412
Vega: OTTHUMG00000030544
Pharos: Q99798(Tbio)
UniProt: Q99798
Position
22q13.2
AA seq 780 aa AA seqDB search
MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLN
RPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAV
PSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILEN
YAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSG
WSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYN
HRMKKYLSKTGREDIANLADEFKDHLVPDPGCHYDQLIEINLSELKPHINGPFTPDLAHP
VAEVGKVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGS
EQIRATIERDGYAQILRDLGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRN
DANPETHAFVTSPEIVTALAIAGTLKFNPETDYLTGTDGKKFRLEAPDADELPKGEFDPG
QDTYQHPPKDSSGQHVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAA
GPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVI
GDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHP
VDKLTIQGLKDFTPGKPLKCIIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQQ
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctacagcctactggtgactcggctgcagaaagctctgggtgtgcggcagtac
catgtggcctcagtcctgtgccaacgggccaaggtggcgatgagccactttgagcccaac
gagtacatccattatgacctgctagagaagaacattaacattgttcgcaaacgactgaac
cggccgctgacactctcggagaagattgtgtatggacacctggatgaccccgccagccag
gaaattgagcgaggcaagtcgtacctgcggctgcggccggaccgtgtggccatgcaggat
gcgacggcccagatggccatgctccagttcatcagcagcgggctgtccaaggtggctgtg
ccatccaccatccactgtgaccatctgattgaagcccaggttgggggcgagaaagacctg
cgccgggccaaggacatcaaccaggaagtttataatttcctggcaactgcaggtgccaaa
tatggcgtgggcttctggaagcctggatctggaatcattcaccagattattctggaaaac
tatgcgtaccctggtgttcttctgattggcactgactcccacacccccaatggtggcggc
cttgggggcatctgcattggagttgggggtgccgatgctgtggatgtcatggctgggatc
ccctgggagctgaagtgccccaaggtgattggcgtgaagctgacgggctctctctccggt
tggtcctcacccaaagatgtgatcctgaaggtggcaggcatcctcacggtgaaaggtggc
acaggtgcaatcgtggaataccacgggcctggtgtagactccatctcctgcactggcatg
gcgacaatctgcaacatgggtgcagaaattggggccaccacttccgtgttcccttacaac
cacaggatgaagaagtacctgagcaagaccggccgggaagacattgccaatctagctgat
gaattcaaggatcacttggtgcctgaccctggctgccattatgaccaactaattgaaatt
aacctcagtgagctgaagccacacatcaatgggcccttcacccctgacctggctcaccct
gtggcagaagtgggcaaggtggcagagaaggaaggatggcctctggacatccgagtgggt
ctaattggtagctgcaccaattcaagctatgaagatatggggcgctcagcagctgtggcc
aagcaggcactggcccatggcctcaagtgcaagtcccagttcaccatcactccaggttcc
gagcagatccgcgccaccattgagcgggacggctatgcacagatcttgagggatctgggt
ggcattgtcctggccaatgcttgtggcccctgcattggccagtgggacaggaaggacatc
aagaagggggagaagaacacaatcgtcacctcctacaacaggaacttcacgggccgcaac
gacgcaaaccccgagacccatgcctttgtcacgtccccagagattgtcacagccctggcc
attgcgggaaccctcaagttcaacccagagaccgactacctgacgggcacggatggcaag
aagttcaggctggaggctccggatgcagatgagcttcccaaaggggagtttgacccaggg
caggacacctaccagcacccacccaaggacagcagcgggcagcatgtggacgtgagcccc
accagccagcgcctgcagctcctggagccttttgacaagtgggatggcaaggacctggag
gacctgcagatcctcatcaaggtcaaagggaagtgtaccactgaccacatctcagctgct
ggcccctggctcaagttccgtgggcacttggataacatctccaacaacctgctcattggt
gccatcaacattgaaaacggcaaggccaactccgtgcgcaatgccgtcactcaggagttt
ggccccgtccctgacactgcccgctactacaagaaacatggcatcaggtgggtggtgatc
ggagacgagaactacggcgagggctcgagccgggagcatgcagctctggagcctcgccac
cttgggggccgggccatcatcaccaagagctttgccaggatccacgagaccaacctgaag
aaacagggcctgctgcctctgaccttcgctgacccggctgactacaacaagattcaccct
gtggacaagctgaccattcagggcctgaaggacttcacccctggcaagcccctgaagtgc
atcatcaagcaccccaacgggacccaggagaccatcctcctgaaccacaccttcaacgag
acgcagattgagtggttccgcgctggcagtgccctcaacagaatgaaggaactgcaacag
tga

DBGET integrated database retrieval system