KEGG   Homo sapiens (human): 5000Help
Entry
5000              CDS       T01001                                 

Gene name
ORC4, ORC4L, ORC4P
Definition
origin recognition complex, subunit 4
Orthology
K02606  
origin recognition complex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Module
Origin recognition complex
Disease
H00464  
Patella dysplasias
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q22-q23
AA seq 436 aa AA seqDB search
MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGES
NSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNL
ENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDIS
QSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEF
PDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAV
DLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRK
AHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPN
CPTDVRQWATSSLSWL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtcgtaaatcaaagagtaacagcttaattcacacagagtgcctttcacaggta
caaagaattttacgtgaaagattttgtcgtcagagtccacatagtaacctatttggagtg
caagtacaatacaaacacttaagtgagctgctgaaaagaactgctctccatggagagagt
aactctgtccttattatcggaccccgaggatcaggaaaaactatgttaataaatcatgct
ttgaaagaactcatggaaatagaagaagtgagtgaaaatgtattacaagttcacttaaat
ggactgctgcagatcaatgacaaaatcgccctaaaggaaatcacaaggcagttaaatctg
gaaaatgtagttggagataaagtttttggaagctttgctgaaaacctttcatttcttctg
gaagctttaaaaaaaggtgaccgaactagcagttgcccagtgatcttcatattagatgaa
tttgatctttttgctcatcataaaaaccaaacacttctctataatctttttgacatttct
cagtctgcacagaccccaatagcagttattggtcttacatgtagattggatattttggaa
ctcttagaaaaaagagtgaagtcaagattttctcaccggcagatacacttaatgaattca
tttggttttccacagtatgttaaaatatttaaagaacagttatctctacctgcagagttt
ccagacaaggtttttgctgagaagtggaatgaaaatgttcagtatctctcagaagataga
agtgtgcaagaagtactacagaagcatttcaatatcagcaaaaacctgcggtcattacac
atgctattgatgcttgctttaaatcgagtaacagcatcgcacccatttatgactgccgta
gatctaatggaagcaagccaactgtgtagcatggactcgaaagcaaatattgtacatggt
ctatcagtcttggaaatctgtcttataatagcaatgaaacatttaaatgacatctatgag
gaagagccatttaattttcaaatggtctataatgagtttcagaagtttgttcaaaggaaa
gcacattccgtttataattttgaaaaacctgttgtcatgaaggcttttgaacacttgcag
caattagaattaataaagcccatggaaagaacttcaggaaattcacagagagagtaccag
ctgatgaaactgcttttggataatactcaaattatgaatgctctgcagaaatatcccaac
tgtcctacagatgtgaggcagtgggcaacatcctcactaagctggttatga

DBGET integrated database retrieval system