KEGG   Homo sapiens (human): 5001Help
Entry
5001              CDS       T01001                                 

Gene name
ORC5, ORC5L, ORC5P, ORC5T, PPP1R117
Definition
(RefSeq) origin recognition complex subunit 5
  KO
K02607  origin recognition complex subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Module
hsa_M00284  Origin recognition complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    5001 (ORC5)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5001 (ORC5)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    5001 (ORC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ORC5_C AAA_16 AAA_22 Kinesin PIF1 AAA_24
Motif
Other DBs
NCBI-GeneID: 5001
NCBI-ProteinID: NP_002544
OMIM: 602331
HGNC: 8491
Ensembl: ENSG00000164815
Vega: OTTHUMG00000157275
Pharos: O43913(Tbio)
UniProt: O43913 A4D0P7 Q53FC8
Structure
PDB: 

Jmol
Position
7q22.1-q22.2
AA seq 435 aa AA seqDB search
MPHLENVVLCRESQVSILQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVF
VNCVECFTLRLLLEQILNKLNHLSSSEDGCSTEITCETFNDFVRLFKQVTTAENLKDQTV
YIVLDKAEYLRDMEANLLPGFLRLQELADRNVTVLFLSEIVWEKFRPNTGCFEPFVLYFP
DYSIGNLQKILSHDHPPEYSADFYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPV
VKGEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHV
ELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLD
RLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIA
RTVNFDIIKYLYDFL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgccccacttggaaaacgtggtgctttgtcgcgagtctcaagtgtccatcttgcagtcc
ttgtttggagagagacatcatttcagctttccatccatttttatttatggacatactgct
agtggaaagacctatgtaacacaaacgttgttgaaaactttagagctcccacatgtgttt
gtgaattgtgttgaatgctttacattgaggctgcttttggaacaaattttaaacaaattg
aatcatcttagttcttcagaggatggatgttctactgaaataacctgtgaaacatttaat
gactttgttcgcttgtttaaacaagtaaccacagctgaaaatcttaaagatcagactgta
tatattgttctagataaagcagagtatctaagagatatggaagcaaatcttttgcctgga
tttcttagattacaagaattggctgacagaaatgtgactgttctctttctcagtgaaatt
gtttgggaaaagtttcgtccaaatactggatgctttgagccgtttgtcttatatttccct
gattacagcataggcaaccttcaaaagatcctgtcccatgatcatcctccagagtattca
gctgatttctatgctgcctacattaacattcttcttggagttttctacactgtttgtcga
gatttgaaagagctcagacatctggcagtacttaattttcctaaatattgtgaacccgtg
gttaaaggagaagcaagtgaacgtgatactcgcaaactgtggagaaatattgaacctcat
ttgaagaaagctatgcagactgtttatctcagggaaatatcaagttcccagtgggaaaag
ctacagaaagatgacacagatccggggcaactgaaaggcctctcagcgcatactcatgtg
gaacttccatattactctaagttcattctaattgctgcataccttgcttcatacaatcca
gcaagaactgacaagaggttttttcttaagcatcatggaaaaatcaagaaaaccaacttt
ctaaaaaaacacgaaaagacaagcaatcatctccttgggccaaaaccatttccactagac
agattattagcaatattatatagtatcgtggacagcagagttgctccaacagcaaatatt
ttttcccagattacctctctagtgacccttcagctgttaaccctggttggccatgacgat
cagcttgatggaccaaaatacaaatgcacagtgtctctagacttcatcagagctattgca
aggacggtgaactttgacataataaaatacttgtatgatttcttgtga

DBGET integrated database retrieval system