KEGG   Homo sapiens (human): 5001Help
Entry
5001              CDS       T01001                                 

Gene name
ORC5, ORC5L, ORC5P, ORC5T
Definition
origin recognition complex, subunit 5
Orthology
K02607  
origin recognition complex subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Module
Origin recognition complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    5001 (ORC5)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5001 (ORC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q22.1
AA seq 435 aa AA seqDB search
MPHLENVVLCRESQVSILQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVF
VNCVECFTLRLLLEQILNKLNHLSSSEDGCSTEITCETFNDFVRLFKQVTTAENLKDQTV
YIVLDKAEYLRDMEANLLPGFLRLQELADRNVTVLFLSEIVWEKFRPNTGCFEPFVLYFP
DYSIGNLQKILSHDHPPEYSADFYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPV
VKGEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHV
ELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLD
RLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIA
RTVNFDIIKYLYDFL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgccccacttggaaaacgtggtgctttgtcgcgagtctcaagtgtccatcttgcagtcc
ttgtttggagagagacatcatttcagctttccatccatttttatttatggacatactgct
agtggaaagacctatgtaacacaaacgttgttgaaaactttagagctcccacatgtgttt
gtgaattgtgttgaatgctttacattgaggctgcttttggaacaaattttaaacaaattg
aatcatcttagttcttcagaggatggatgttctactgaaataacctgtgaaacatttaat
gactttgttcgcttgtttaaacaagtaaccacagctgaaaatcttaaagatcagactgta
tatattgttctagataaagcagagtatctaagagatatggaagcaaatcttttgcctgga
tttcttagattacaagaattggctgacagaaatgtgactgttctctttctcagtgaaatt
gtttgggaaaagtttcgtccaaatactggatgctttgagccgtttgtcttatatttccct
gattacagcataggcaaccttcaaaagatcctgtcccatgatcatcctccagagtattca
gctgatttctatgctgcctacattaacattcttcttggagttttctacactgtttgtcga
gatttgaaagagctcagacatctggcagtacttaattttcctaaatattgtgaacccgtg
gttaaaggagaagcaagtgaacgtgatactcgcaaactgtggagaaatattgaacctcat
ttgaagaaagctatgcagactgtttatctcagggaaatatcaagttcccagtgggaaaag
ctacagaaagatgacacagatccggggcaactgaaaggcctctcagcgcatactcatgtg
gaacttccatattactctaagttcattctaattgctgcataccttgcttcatacaatcca
gcaagaactgacaagaggttttttcttaagcatcatggaaaaatcaagaaaaccaacttt
ctaaaaaaacacgaaaagacaagcaatcatctccttgggccaaaaccatttccactagac
agattattagcaatattatatagtatcgtggacagcagagttgctccaacagcaaatatt
ttttcccagattacctctctagtgacccttcagctgttaaccctggttggccatgacgat
cagcttgatggaccaaaatacaaatgcacagtgtctctagacttcatcagagctattgca
aggacggtgaactttgacataataaaatacttgtatgatttcttgtga

DBGET integrated database retrieval system