KEGG   Homo sapiens (human): 5008Help
Entry
5008              CDS       T01001                                 

Gene name
OSM
Definition
oncostatin M
Orthology
K05418  
oncostatin M
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    5008 (OSM)
   04151 PI3K-Akt signaling pathway
    5008 (OSM)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    5008 (OSM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q12.2
AA seq 252 aa AA seqDB search
MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYI
RIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKA
QDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTP
ASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRK
GKRLMTRGQLPR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgggggtactgctcacacagaggacgctgctcagtctggtccttgcactcctgtttcca
agcatggcgagcatggcggctataggcagctgctcgaaagagtaccgcgtgctccttggc
cagctccagaagcagacagatctcatgcaggacaccagcagactcctggacccctatata
cgtatccaaggcctggatgttcctaaactgagagagcactgcagggagcgccccggggcc
ttccccagtgaggagaccctgagggggctgggcaggcggggcttcctgcagaccctcaat
gccacactgggctgcgtcctgcacagactggccgacttagagcagcgcctccccaaggcc
caggatttggagaggtctgggctgaacatcgaggacttggagaagctgcagatggcgagg
ccgaacatcctcgggctcaggaacaacatctactgcatggcccagctgctggacaactca
gacacggctgagcccacgaaggctggccggggggcctctcagccgcccacccccacccct
gcctcggatgcttttcagcgcaagctggagggctgcaggttcctgcatggctaccatcgc
ttcatgcactcagtggggcgggtcttcagcaagtggggggagagcccgaaccggagccgg
agacacagcccccaccaggccctgaggaagggggtgcgcaggaccagaccctccaggaaa
ggcaagagactcatgaccaggggacagctgccccggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system