KEGG   Homo sapiens (human): 5009Help
Entry
5009              CDS       T01001                                 

Gene name
OTC, OCTD
Definition
ornithine carbamoyltransferase (EC:2.1.3.3)
Orthology
K00611  
ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Disease
H00187  
Ornithine transcarbamylase deficiency
H01398  
Primary hyperammonemic disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    5009 (OTC)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    5009 (OTC)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     5009 (OTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp21.1
AA seq 354 aa AA seqDB search
MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLS
ADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGV
NESLTDTARVLSSMADAVLARVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQ
EHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKEN
GTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWTF
LHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttaatctgaggatcctgttaaacaatgcagcttttagaaatggtcacaacttc
atggttcgaaattttcggtgtggacaaccactacaaaataaagtgcagctgaagggccgt
gaccttctcactctaaaaaactttaccggagaagaaattaaatatatgctatggctatca
gcagatctgaaatttaggataaaacagaaaggagagtatttgcctttattgcaagggaag
tccttaggcatgatttttgagaaaagaagtactcgaacaagattgtctacagaaacaggc
tttgcacttctgggaggacatccttgttttcttaccacacaagatattcatttgggtgtg
aatgaaagtctcacggacacggcccgtgtattgtctagcatggcagatgcagtattggct
cgagtgtataaacaatcagatttggacaccctggctaaagaagcatccatcccaattatc
aatgggctgtcagatttgtaccatcctatccagatcctggctgattacctcacgctccag
gaacactatagctctctgaaaggtcttaccctcagctggatcggggatgggaacaatatc
ctgcactccatcatgatgagcgcagcgaaattcggaatgcaccttcaggcagctactcca
aagggttatgagccggatgctagtgtaaccaagttggcagagcagtatgccaaagagaat
ggtaccaagctgttgctgacaaatgatccattggaagcagcgcatggaggcaatgtatta
attacagacacttggataagcatgggacaagaagaggagaagaaaaagcggctccaggct
ttccaaggttaccaggttacaatgaagactgctaaagttgctgcctctgactggacattt
ttacactgcttgcccagaaagccagaagaagtggatgatgaagtcttttattctcctcga
tcactagtgttcccagaggcagaaaacagaaagtggacaatcatggctgtcatggtgtcc
ctgctgacagattactcacctcagctccagaagcctaaattttga

DBGET integrated database retrieval system