KEGG   Homo sapiens (human): 5010Help
Entry
5010              CDS       T01001                                 

Gene name
CLDN11, OSP, OTM
Definition
(RefSeq) claudin 11
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5010 (CLDN11)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    5010 (CLDN11)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    5010 (CLDN11)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    5010 (CLDN11)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   5010 (CLDN11)
  Exosomal proteins of colorectal cancer cells
   5010 (CLDN11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF3273
Motif
Other DBs
NCBI-GeneID: 5010
NCBI-ProteinID: NP_005593
OMIM: 601326
HGNC: 8514
Ensembl: ENSG00000013297
Vega: OTTHUMG00000158940
Pharos: O75508(Tbio)
UniProt: O75508
Position
3q26.2
AA seq 207 aa AA seqDB search
MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMAT
GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRA
QLAGVLLILLALCALVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAG
DAQAFGENRFYYTAGSSSPTHAKSAHV
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggtggccacgtgcctgcaggtggtgggcttcgtcacgagcttcgtgggctggatcggg
gtcatcgtgaccacctccaccaatgactgggtggtgacctgcggctacaccatccccacc
tgccgcaagctggatgagctgggctccaaggggctgtgggccgactgcgtcatggccacg
gggctgtaccactgcaagcccctggtggacatcctcatcctgccgggctacgtgcaggcc
tgccgcgccctgatgattgctgcctcggtcctgggtctgccggccattttactgctgctg
actgttcttccctgcatccggatgggccaggagcccggtgtggctaagtacaggcgggcc
cagctggctggtgttttgctcattctgctggctctctgcgcccttgttgccaccatctgg
ttccctgtgtgcgcccaccgtgagaccaccatcgtgagctttggctactccctgtatgca
ggctggattggtgctgtgctgtgcctcgtgggtggctgtgtcatcctctgctgcgctgga
gatgcccaggcctttggtgaaaaccgtttctactacactgcgggctctagctccccgact
catgcgaagagtgcccacgtataa

DBGET integrated database retrieval system