KEGG   Homo sapiens (human): 5010Help
Entry
5010              CDS       T01001                                 

Gene name
CLDN11, OSP, OTM
Definition
claudin 11
Orthology
K06087  
claudin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5010 (CLDN11)
 Cellular Processes
  Cell communication
   04530 Tight junction
    5010 (CLDN11)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    5010 (CLDN11)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    5010 (CLDN11)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   5010 (CLDN11)
  Exosomal proteins of colorectal cancer cells
   5010 (CLDN11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
3q26.2-q26.3
AA seq 123 aa AA seqDB search
MIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIWFPVC
AHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKS
AHV
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgattgctgcctcggtcctgggtctgccggccattttactgctgctgactgttcttccc
tgcatccggatgggccaggagcccggtgtggctaagtacaggcgggcccagctggctggt
gttttgctcattctgctggctctctgcgcccttgttgccaccatctggttccctgtgtgc
gcccaccgtgagaccaccatcgtgagctttggctactccctgtatgcaggctggattggt
gctgtgctgtgcctcgtgggtggctgtgtcatcctctgctgcgctggagatgcccaggcc
tttggtgaaaaccgtttctactacactgcgggctctagctccccgactcatgcgaagagt
gcccacgtataa

DBGET integrated database retrieval system