KEGG   Homo sapiens (human): 5010Help
Entry
5010              CDS       T01001                                 

Gene name
CLDN11, OSP, OTM
Definition
claudin 11
Orthology
K06087  
claudin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
3q26.2-q26.3
AA seq 123 aa AA seqDB search
MIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIWFPVC
AHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKS
AHV
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgattgctgcctcggtcctgggtctgccggccattttactgctgctgactgttcttccc
tgcatccggatgggccaggagcccggtgtggctaagtacaggcgggcccagctggctggt
gttttgctcattctgctggctctctgcgcccttgttgccaccatctggttccctgtgtgc
gcccaccgtgagaccaccatcgtgagctttggctactccctgtatgcaggctggattggt
gctgtgctgtgcctcgtgggtggctgtgtcatcctctgctgcgctggagatgcccaggcc
tttggtgaaaaccgtttctactacactgcgggctctagctccccgactcatgcgaagagt
gcccacgtataa

DBGET integrated database retrieval system