KEGG   Homo sapiens (human): 5018Help
Entry
5018              CDS       T01001                                 

Gene name
OXA1L, OXA1
Definition
oxidase (cytochrome c) assembly 1-like
Orthology
K03217  
YidC/Oxa1 family membrane protein insertase
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:hsa03060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q11.2
AA seq 495 aa AA seqDB search
MVTWLYRFLPTSNMAAKLRSLLPPDLRLQFWLHARLQKCFLSRGCGSYCAGAKASPLPGK
MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPAAPCCCRPHYLFLAASG
PRSLSTSAISFAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAELGLGSYT
PVGLIQNLLEFMHVDLGLPWWGAIAACTVFARCLIFPLIVTGQREAARIHNHLPEIQKFS
SRIREAKLAGDHIEYYKASSEMALYQKKHGIKLYKPLILPVTQAPIFISFFIALREMANL
PVPSLQTGGLWWFQDLTVSDPIYILPLAVTATMWAVLELGAETGVQSSDLQWMRNVIRMM
PLITLPITMHFPTAVFMYWLSSNLFSLVQVSCLRIPAVRTVLKIPQRVVHDLDKLPPREG
FLESFKKGWKNAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS
SSKPKSKYPWHDTLG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggtaacgtggctttacagatttttacccacttcaaatatggccgccaagctccgttct
cttttaccgcctgatctgcggctacaattctggcttcatgcccgcctccaaaagtgcttc
ctctcgaggggttgtggttcttactgcgcaggcgcaaaagcaagtcctcttccgggcaaa
atggcgatgggactaatgtgcggacgccgggagcttctgcgcttgctacagtccgggcgt
cgggtccacagcgtcgcagggccctcgcaatggcttgggaaaccgctgaccacacggctc
ctattcccagcagccccgtgctgctgtcgcccacactacctcttccttgcggcttccggc
ccccgcagcctcagtacctctgctatctcttttgcagaagtccaggttcaggcccctcct
gttgttgctgcaactccctcacccacagcagtacctgaggtggcttctggagagactgca
gatgtagtccaaactgctgcagagcagagcttcgctgaactggggctggggtcatacacc
ccagtgggactgatccagaatttactggaatttatgcatgttgatctgggcctaccttgg
tggggggccattgctgcatgtacagtctttgcccgctgcctgatttttcctctcatcgtg
acgggccagcgagaggcagccaggatccacaatcacttgccagagatccagaagttttcc
agtcgaatcagagaggccaagttagcaggagaccatattgagtattacaaggcttcctcg
gagatggcactttaccagaaaaaacatggtattaaactctataaacctctcattctccct
gtgactcaggccccaatcttcatctccttcttcattgctttgagagagatggccaacctt
cctgtgcccagcctgcagacaggtggcctctggtggttccaggatctcacggtatccgat
cccatctacatattaccactggcagtcactgctacaatgtgggctgttcttgagctaggt
gctgagacaggtgtgcaaagttctgaccttcagtggatgagaaatgtcatcagaatgatg
cccctgataaccttgcccataaccatgcatttccccacggcagtgtttatgtactggctc
tcctccaatttgttttccctggtccaagtatcctgtctccggattccagcagtacgcact
gtacttaaaatcccccagcgtgttgtacatgacctggacaaattacctccacgggaaggc
ttcctagagagcttcaaaaaaggctggaaaaatgctgaaatgacgcgtcagctgcgagag
cgtgaacaacgcatgcggaatcagttggagctagcagccaggggtcctttacgacagacc
tttacccacaaccctctcctacaacctggaaaggataaccctcccaatatccctagcagc
agcagcaaaccaaagtcaaagtatccctggcacgacacacttggctga

DBGET integrated database retrieval system