KEGG   Homo sapiens (human): 5021Help
Entry
5021              CDS       T01001                                 

Gene name
OXTR, OT-R
Definition
oxytocin receptor
Orthology
K04229  
oxytocin receptor
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Oxytocin signaling pathway
Drug target
Atosiban: 
Demoxytocin: 
Oxytocin: 
Carbetocin: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5021 (OXTR)
   04024 cAMP signaling pathway
    5021 (OXTR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5021 (OXTR)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    5021 (OXTR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Oxytocin
    5021 (OXTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p25
AA seq 389 aa AA seqDB search
MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACV
LLALRTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVW
DANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGET
SASKKSNSSSFVLSHRSSSQRSCSQPSTA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgcgctcgcagccaactggagcgccgaggcagccaacgccagcgccgcgccg
ccgggggccgagggcaaccgcaccgccggacccccgcggcgcaacgaggccctggcgcgc
gtggaggtggcggtgctgtgtctcatcctgctcctggcgctgagcgggaacgcgtgtgtg
ctgctggcgctgcgcaccacacgccagaagcactcgcgcctcttcttcttcatgaagcac
ctaagcatcgccgacctggtggtggcagtgtttcaggtgctgccgcagttgctgtgggac
atcaccttccgcttctacgggcccgacctgctgtgccgcctggtcaagtacttgcaggtg
gtgggcatgttcgcctccacctacctgctgctgctcatgtccctggaccgctgcctggcc
atctgccagccgctgcgctcgctgcgccgccgcaccgaccgcctggcagtgctcgccacg
tggctcggctgcctggtggccagcgcgccgcaggtgcacatcttctctctgcgcgaggtg
gctgacggcgtcttcgactgctgggccgtcttcatccagccctggggacccaaggcctac
atcacatggatcacgctagctgtctacatcgtgccggtcatcgtgctcgctgcctgctac
ggccttatcagcttcaagatctggcagaacttgcggctcaagaccgctgcagcggcggcg
gccgaggcgccagagggcgcggcggctggcgatggggggcgcgtggccctggcgcgtgtc
agcagcgtcaagctcatctccaaggccaagatccgcacggtcaagatgactttcatcatc
gtgctggccttcatcgtgtgctggacgcctttcttcttcgtgcagatgtggagcgtctgg
gatgccaacgcgcccaaggaagcctcggccttcatcatcgtcatgctcctggccagcctc
aacagctgctgcaacccctggatctacatgctgttcacgggccacctcttccacgaactc
gtgcagcgcttcctgtgctgctccgccagctacctgaagggcagacgcctgggagagacg
agtgccagcaaaaagagcaactcgtcctcctttgtcctgagccatcgcagctccagccag
aggagctgctcccagccatccacggcgtga

DBGET integrated database retrieval system