KEGG   Homo sapiens (human): 5021Help
Entry
5021              CDS       T01001                                 

Gene name
OXTR, OT-R
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04921  Oxytocin signaling pathway
Drug target
Atosiban (DG02835): D03008 D07475
Carbetocin: D07229
Cargutocin: D09797
Demoxytocin: D07228
Epelsiban (DG01543): D10117 D10118
Oxytocin: D00089
Retosiban: D08986
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5021 (OXTR)
   04024 cAMP signaling pathway
    5021 (OXTR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5021 (OXTR)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    5021 (OXTR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Oxytocin
    5021 (OXTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 5021
NCBI-ProteinID: NP_000907
OMIM: 167055
HGNC: 8529
Ensembl: ENSG00000180914
Vega: OTTHUMG00000090537
Pharos: P30559(Tclin)
UniProt: P30559 B2R9L7
Position
3p25.3
AA seq 389 aa AA seqDB search
MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACV
LLALRTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVW
DANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGET
SASKKSNSSSFVLSHRSSSQRSCSQPSTA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgcgctcgcagccaactggagcgccgaggcagccaacgccagcgccgcgccg
ccgggggccgagggcaaccgcaccgccggacccccgcggcgcaacgaggccctggcgcgc
gtggaggtggcggtgctgtgtctcatcctgctcctggcgctgagcgggaacgcgtgtgtg
ctgctggcgctgcgcaccacacgccagaagcactcgcgcctcttcttcttcatgaagcac
ctaagcatcgccgacctggtggtggcagtgtttcaggtgctgccgcagttgctgtgggac
atcaccttccgcttctacgggcccgacctgctgtgccgcctggtcaagtacttgcaggtg
gtgggcatgttcgcctccacctacctgctgctgctcatgtccctggaccgctgcctggcc
atctgccagccgctgcgctcgctgcgccgccgcaccgaccgcctggcagtgctcgccacg
tggctcggctgcctggtggccagcgcgccgcaggtgcacatcttctctctgcgcgaggtg
gctgacggcgtcttcgactgctgggccgtcttcatccagccctggggacccaaggcctac
atcacatggatcacgctagctgtctacatcgtgccggtcatcgtgctcgctgcctgctac
ggccttatcagcttcaagatctggcagaacttgcggctcaagaccgctgcagcggcggcg
gccgaggcgccagagggcgcggcggctggcgatggggggcgcgtggccctggcgcgtgtc
agcagcgtcaagctcatctccaaggccaagatccgcacggtcaagatgactttcatcatc
gtgctggccttcatcgtgtgctggacgcctttcttcttcgtgcagatgtggagcgtctgg
gatgccaacgcgcccaaggaagcctcggccttcatcatcgtcatgctcctggccagcctc
aacagctgctgcaacccctggatctacatgctgttcacgggccacctcttccacgaactc
gtgcagcgcttcctgtgctgctccgccagctacctgaagggcagacgcctgggagagacg
agtgccagcaaaaagagcaactcgtcctcctttgtcctgagccatcgcagctccagccag
aggagctgctcccagccatccacggcgtga

DBGET integrated database retrieval system