KEGG   Homo sapiens (human): 5023Help
Entry
5023              CDS       T01001                                 

Gene name
P2RX1, P2X1
Definition
purinergic receptor P2X, ligand-gated ion channel, 1
Orthology
K05215  
P2X purinoceptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Suramin sodium: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.3
AA seq 399 aa AA seqDB search
MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSG
LISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEH
PEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLR
EAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESG
QNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVEN
GTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKR
HYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcggttccaggaggagctggccgccttcctcttcgagtatgacaccccccgc
atggtgctggtgcgtaataagaaggtgggcgttatcttccgactgatccagctggtggtc
ctggtctacgtcatcgggtgggtgtttctctatgagaagggctaccagacctcgagcggc
ctcatcagcagtgtctctgtgaaactcaagggcctggccgtgacccagctccctggcctc
ggcccccaggtctgggatgtggctgactacgtcttcccagcccagggggacaactccttc
gtggtcatgaccaatttcatcgtgaccccgaagcagactcaaggctactgcgcagagcac
ccagaagggggcatatgcaaggaagacagtggctgtacccctgggaaggccaagaggaag
gcccaaggcatccgcacgggcaagtgtgtggccttcaacgacactgtgaagacgtgtgag
atctttggctggtgccccgtggaggtggatgacgacatcccgcgccctgcccttctccga
gaggccgagaacttcactcttttcatcaagaacagcatcagctttccacgcttcaaggtc
aacaggcgcaacctggtggaggaggtgaatgctgcccacatgaagacctgcctctttcac
aagaccctgcaccccctgtgcccagtcttccagcttggctacgtggtgcaagagtcaggc
cagaacttcagcaccctggctgagaagggtggagtggttggcatcaccatcgactggcac
tgtgacctggactggcacgtacggcactgcagacccatctatgagttccatgggctgtac
gaagagaaaaatctctccccaggcttcaacttcaggtttgccaggcactttgtggagaac
gggaccaactaccgtcacctcttcaaggtgtttgggattcgctttgacatcctggtggac
ggcaaggccgggaagtttgacatcatccctacaatgaccaccatcggctctggaattggc
atctttggggtggccacagttctctgtgacctgctgctgcttcacatcctgcctaagagg
cactactacaagcagaagaagttcaaatacgctgaggacatggggccaggggcggctgag
cgtgacctcgcagctaccagctccaccctgggcctgcaggagaacatgaggacatcctga

DBGET integrated database retrieval system