KEGG   Homo sapiens (human): 5024Help
Entry
5024              CDS       T01001                                 

Gene name
P2RX3, P2X3
Definition
purinergic receptor P2X, ligand-gated ion channel, 3
Orthology
K05217  
P2X purinoceptor 3
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Suramin sodium: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5024 (P2RX3)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5024 (P2RX3)
Ion channels [BR:hsa04040]
 Epithelial and related channels
  ATP-gated cation channel (P2X)
   5024 (P2RX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
11q12
AA seq 397 aa AA seqDB search
MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDS
QCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVETPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADQYKAKKFEE
VNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactgcatatccgacttcttcacctatgagaccaccaagtcggtggttgtgaagagc
tggaccatcgggatcatcaaccgagtagttcagcttctgatcatctcctactttgtaggg
tgggttttcttgcacgagaaggcttaccaggtacgggacacagccattgagtcctcggtg
gtaaccaaggtgaagggctccggactctacgccaacagagtcatggatgtgtctgattac
gtgacgccacctcagggcacctcggtctttgtcatcatcaccaagatgattgttactgaa
aatcagatgcaaggattctgcccagagagtgaggagaaataccgctgtgtatcagacagc
cagtgcgggcctgagcgcttgccaggtggggggatcctcactggccgctgcgtgaactac
agctctgtgctccggacctgtgagatccagggctggtgccccacggaggtggacacagtg
gaaacgcccatcatgatggaagctgagaacttcactattttcatcaagaacagcatccgt
ttccccctcttcaactttgagaagggaaacctccttcccaacctgacagccagggacatg
aagacctgccgcttccacccggacaaggaccctttctgccccatcttgcgggtaggggac
gtggtcaagtttgcggggcaggattttgccaaactggcgcgcacggggggagttctgggc
attaagatcggctgggtgtgcgacttggacaaggcctgggaccagtgcatccccaaatac
tccttcacccggctcgacagcgtttctgagaaaagcagcgtgtccccaggctacaacttc
aggtttgccaagtactacaaaatggaaaatggcagtgagtaccgcaccctcctgaaggct
tttggcatccgcttcgacgtgctggtatacgggaatgctggcaagttcaacatcatcccc
accatcatcagctctgtggcggcctttacttctgtgggagtgggaactgttctctgtgac
atcatcctgctcaacttcctcaagggggccgaccagtacaaagccaagaagtttgaggag
gtgaatgagactacgctgaaaatcgcggctttgaccaacccagtgtaccccagcgaccag
accacagcggagaagcagtccaccgattcgggggccttctccataggccactag

DBGET integrated database retrieval system