KEGG   Homo sapiens (human): 5025Help
Entry
5025              CDS       T01001                                 

Gene name
P2RX4, P2X4, P2X4R
Definition
(RefSeq) purinergic receptor P2X, ligand gated ion channel, 4
  KO
K05218  
P2X purinoceptor 4
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Suramin sodium: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5025 (P2RX4)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5025 (P2RX4)
Ion channels [BR:hsa04040]
 Epithelial and related channels
  ATP-gated cation channel (P2X)
   5025 (P2RX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.32
AA seq 404 aa AA seqDB search
MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGCYHPHLAEVEMESPR
RWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTN
VILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAW
CPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTD
PFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDV
EHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLA
LLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctgctgcgccgcgctggcggccttcctgttcgagtacgacacgccgcgcatc
gtgctcatccgcagccgcaaagtggggctcatgaaccgcgccgtgcaactgctcatcctg
gcctacgtcatcgggtgctaccatccccatttggcagaagtggaaatggagtcccctaga
aggtgggtgtttgtgtgggaaaagggctaccaggaaactgactccgtggtcagctccgtt
acgaccaaggtcaagggcgtggctgtgaccaacacttctaaacttggattccggatctgg
gatgtggcggattatgtgataccagctcaggaggaaaactccctcttcgtcatgaccaac
gtgatcctcaccatgaaccagacacagggcctgtgccccgagattccagatgcgaccact
gtgtgtaaatcagatgccagctgtactgccggctctgccggcacccacagcaacggagtc
tcaacaggcaggtgcgtagctttcaacgggtctgtcaagacgtgtgaggtggcggcctgg
tgcccggtggaggatgacacacacgtgccacaacctgcttttttaaaggctgcagaaaac
ttcactcttttggttaagaacaacatctggtatcccaaatttaatttcagcaagaggaat
atccttcccaacatcaccactacttacctcaagtcgtgcatttatgatgctaaaacagat
cccttctgccccatattccgtcttggcaaaatagtggagaacgcaggacacagtttccag
gacatggccgtggagggaggcatcatgggcatccaggtcaactgggactgcaacctggac
agagccgcctccctctgcttgcccaggtactccttccgccgcctcgatacacgggacgtt
gagcacaacgtatctcctggctacaatttcaggtttgccaagtactacagagacctggct
ggcaacgagcagcgcacgctcatcaaggcctatggcatccgcttcgacatcattgtgttt
gggaaggcagggaaatttgacatcatccccactatgatcaacatcggctctggcctggca
ctgctaggcatggcgaccgtgctgtgtgacatcatagtcctctactgcatgaagaaaaga
ctctactatcgggagaagaaatataaatatgtggaagattacgagcagggtcttgctagt
gagctggaccagtga

DBGET integrated database retrieval system