KEGG   Homo sapiens (human): 5026Help
Entry
5026              CDS       T01001                                 

Gene name
P2RX5, LRH-1, P2X5, P2X5R
Definition
purinergic receptor P2X, ligand-gated ion channel, 5
Orthology
K05219  
P2X purinoceptor 5
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Suramin sodium: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5026 (P2RX5)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5026 (P2RX5)
Ion channels [BR:hsa04040]
 Epithelial and related channels
  ATP-gated cation channel (P2X)
   5026 (P2RX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.3
AA seq 421 aa AA seqDB search
MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDT
SLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAE
NEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEP
FLKEAEDFTIFIKNHIRFPKFNFSNNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWA
GSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYY
RDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSS
QEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRS
T
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggcgggctgcaaggggctctgcctgtcgctgttcgactacaagaccgagaag
tatgtcatcgccaagaacaagaaggtgggcctgctgtaccggctgctgcaggcctccatc
ctggcgtacctggtcgtatgggtgttcctgataaagaagggttaccaagacgtcgacacc
tccctgcagagtgctgtcatcaccaaagtcaagggcgtggccttcaccaacacctcggat
cttgggcagcggatctgggatgtcgccgactacgtcattccagcccagggagagaacgtc
ttttttgtggtcaccaacctgattgtgacccccaaccagcggcagaacgtctgtgctgag
aatgaaggcattcctgatggcgcgtgctccaaggacagcgactgccacgctggggaagcg
gttacagctggaaacggagtgaagaccggccgctgcctgcggagagagaacttggccagg
ggcacctgtgagatctttgcctggtgcccgttggagacaagctccaggccggaggagcca
ttcctgaaggaggccgaagacttcaccattttcataaagaaccacatccgtttccccaaa
ttcaacttctccaacaatgtgatggacgtcaaggacagatctttcctgaaatcatgccac
tttggccccaagaaccactactgccccatcttccgactgggctccgtgatccgctgggcc
gggagcgacttccaggatatagccctggagggtggcgtgataggaattaatattgaatgg
aactgtgatcttgataaagctgcctctgagtgccaccctcactattcttttagccgtctg
gacaataaactttcaaagtctgtctcctccgggtacaacttcagatttgccagatattac
cgagacgcagccggggtggagttccgcaccctgatgaaagcctacgggatccgctttgac
gtgatggtgaacggcaagggtgctttcttctgcgacctggtactcatctacctcatcaaa
aagagagagttttaccgtgacaagaagtacgaggaagtgaggggcctagaagacagttcc
caggaggccgaggacgaggcatcggggctggggctatctgagcagctcacatctgggcca
gggctgctggggatgccggagcagcaggagctgcaggagccacccgaggcgaagcgtgga
agcagcagtcagaaggggaacggatctgtgtgcccacagctcctggagccccacaggagc
acgtga

DBGET integrated database retrieval system