KEGG   Homo sapiens (human): 5027Help
Entry
5027              CDS       T01001                                 

Gene name
P2RX7, P2X7
Definition
purinergic receptor P2X, ligand-gated ion channel, 7
Orthology
K05220  
P2X purinoceptor 7
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Suramin sodium: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
12q24
AA seq 595 aa AA seqDB search
MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISS
VHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP
EYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPA
LLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGD
NFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTTNVSLYPGYNFRYAKYYK
ENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSS
NCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRS
LQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCG
SCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDS
TNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctgctgcagctgcagtgatgttttccagtatgagacgaacaaagtcactcgg
atccagagcatgaattatggcaccattaagtggttcttccacgtgatcatcttttcctac
gtttgctttgctctggtgagtgacaagctgtaccagcggaaagagcctgtcatcagttct
gtgcacaccaaggtgaaggggatagcagaggtgaaagaggagatcgtggagaatggagtg
aagaagttggtgcacagtgtctttgacaccgcagactacaccttccctttgcaggggaac
tctttcttcgtgatgacaaactttctcaaaacagaaggccaagagcagcggttgtgtccc
gagtatcccacccgcaggacgctctgttcctctgaccgaggttgtaaaaagggatggatg
gacccgcagagcaaaggaattcagaccggaaggtgtgtagtgtatgaagggaaccagaag
acctgtgaagtctctgcctggtgccccatcgaggcagtggaagaggccccccggcctgct
ctcttgaacagtgccgaaaacttcactgtgctcatcaagaacaatatcgacttccccggc
cacaactacaccacgagaaacatcctgccaggtttaaacatcacttgtaccttccacaag
actcagaatccacagtgtcccattttccgactaggagacatcttccgagaaacaggcgat
aatttttcagatgtggcaattcagggcggaataatgggcattgagatctactgggactgc
aacctagaccgttggttccatcactgccgtcccaaatacagtttccgtcgccttgacgac
aagaccaccaacgtgtccttgtaccctggctacaacttcagatacgccaagtactacaag
gaaaacaatgttgagaaacggactctgataaaagtcttcgggatccgttttgacatcctg
gtttttggcaccggaggaaaatttgacattatccagctggttgtgtacatcggctcaacc
ctctcctacttcggtctggccgctgtgttcatcgacttcctcatcgacacttactccagt
aactgctgtcgctcccatatttatccctggtgcaagtgctgtcagccctgtgtggtcaac
gaatactactacaggaagaagtgcgagtccattgtggagccaaagccgacattaaagtat
gtgtcctttgtggatgaatcccacattaggatggtgaaccagcagctactagggagaagt
ctgcaagatgtcaagggccaagaagtcccaagacctgcgatggacttcacagatttgtcc
aggctgcccctggccctccatgacacacccccgattcctggacaaccagaggagatacag
ctgcttagaaaggaggcgactcctagatccagggatagccccgtctggtgccagtgtgga
agctgcctcccatctcaactccctgagagccacaggtgcctggaggagctgtgctgccgg
aaaaagccgggggcctgcatcaccacctcagagctgttcaggaagctggtcctgtccaga
cacgtcctgcagttcctcctgctctaccaggagcccttgctggcgctggatgtggattcc
accaacagccggctgcggcactgtgcctacaggtgctacgccacctggcgcttcggctcc
caggacatggctgactttgccatcctgcccagctgctgccgctggaggatccggaaagag
tttccgaagagtgaagggcagtacagtggcttcaagagtccttactga

DBGET integrated database retrieval system