KEGG   Homo sapiens (human): 5028Help
Entry
5028              CDS       T01001                                 

Gene name
P2RY1, P2Y1
Definition
(RefSeq) purinergic receptor P2Y1
  KO
K04270  
purinergic receptor P2Y, G protein-coupled, 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Neuroactive ligand-receptor interaction
Platelet activation
Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    5028 (P2RY1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5028 (P2RY1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5028 (P2RY1)
  Sensory system
   04742 Taste transduction
    5028 (P2RY1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    5028 (P2RY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q25.2
AA seq 373 aa AA seqDB search
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYIL
VFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG
DAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVV
VAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLI
VRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFND
RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLN
ILPEFKQNGDTSL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggtgctgtggccggctgtccccaacgggacggacgctgccttcctggccggt
ccgggttcgtcctgggggaacagcacggtcgcctccactgccgccgtctcctcgtcgttc
aaatgcgccttgaccaagacgggcttccagttttactacctgccggctgtctacatcttg
gtattcatcatcggcttcctgggcaacagcgtggccatctggatgttcgtcttccacatg
aagccctggagcggcatctccgtgtacatgttcaatttggctctggccgacttcttgtac
gtgctgactctgccagccctgatcttctactacttcaataaaacagactggatcttcggg
gatgccatgtgtaaactgcagaggttcatctttcatgtgaacctctatggcagcatcttg
tttctgacatgcatcagtgcccaccggtacagcggtgtggtgtaccccctcaagtccctg
ggccggctcaaaaagaagaatgcgatctgtatcagcgtgctggtgtggctcattgtggtg
gtggcgatctcccccatcctcttctactcaggtaccggggtccgcaaaaacaaaaccatc
acctgttacgacaccacctcagacgagtacctgcgaagttatttcatctacagcatgtgc
acgaccgtggccatgttctgtgtccccttggtgctgattctgggctgttacggattaatt
gtgagagctttgatttacaaagatctggacaactctcctctgaggagaaaatcgatttac
ctggtaatcattgtactgactgtttttgctgtgtcttacatccctttccatgtgatgaaa
acgatgaacttgagggcccggcttgattttcagaccccagcaatgtgtgctttcaatgac
agggtttatgccacgtatcaggtgacaagaggtctagcaagtctcaacagttgtgtggac
cccattctctatttcttggcgggagatactttcagaaggagactctcccgagccacaagg
aaagcttctagaagaagtgaggcaaatttgcaatccaagagtgaagacatgaccctcaat
attttacctgagttcaagcagaatggagatacaagcctgtga

DBGET integrated database retrieval system