KEGG   Homo sapiens (human): 5029Help
Entry
5029              CDS       T01001                                 

Gene name
P2RY2, HP2U, P2RU1, P2U, P2U1, P2UR, P2Y2, P2Y2R
Definition
(RefSeq) purinergic receptor P2Y2
  KO
K04269  
purinergic receptor P2Y, G protein-coupled, 2
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Inflammatory mediator regulation of TRP channels
Drug target
Diquafosol tetrasodium: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5029 (P2RY2)
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5029 (P2RY2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    5029 (P2RY2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.4
AA seq 377 aa AA seqDB search
MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVLGLCLNAVALYIFLC
RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS
ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR
VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK
RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC
LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR
RTESTPAGSENTKDIRL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagacctgggcccctggaatgacaccatcaatggcacctgggatggggatgag
ctgggctacaggtgccgcttcaacgaggacttcaagtacgtgctgctgcctgtgtcctac
ggcgtggtgtgcgtgcttgggctgtgtctgaacgccgtggcgctctacatcttcttgtgc
cgcctcaagacctggaatgcgtccaccacatatatgttccacctggctgtgtctgatgca
ctgtatgcggcctccctgccgctgctggtctattactacgcccgcggcgaccactggccc
ttcagcacggtgctctgcaagctggtgcgcttcctcttctacaccaacctttactgcagc
atcctcttcctcacctgcatcagcgtgcaccggtgtctgggcgtcttacgacctctgcgc
tccctgcgctggggccgggcccgctacgctcgccgggtggccggggccgtgtgggtgttg
gtgctggcctgccaggcccccgtgctctactttgtcaccaccagcgcgcgcgggggccgc
gtaacctgccacgacacctcggcacccgagctcttcagccgcttcgtggcctacagctca
gtcatgctgggcctgctcttcgcggtgccctttgccgtcatccttgtctgttacgtgctc
atggctcggcgactgctaaagccagcctacgggacctcgggcggcctgcctagggccaag
cgcaagtccgtgcgcaccatcgccgtggtgctggctgtcttcgccctctgcttcctgcca
ttccacgtcacccgcaccctctactactccttccgctcgctggacctcagctgccacacc
ctcaacgccatcaacatggcctacaaggttacccggccgctggccagtgctaacagttgc
cttgaccccgtgctctacttcctggctgggcagaggctcgtacgctttgcccgagatgcc
aagccacccactggccccagccctgccaccccggctcgccgcaggctgggcctgcgcaga
tccgacagaactgacatgcagaggatagaagatgtgttgggcagcagtgaggactctagg
cggacagagtccacgccggctggtagcgagaacactaaggacattcggctgtag

DBGET integrated database retrieval system