KEGG   Homo sapiens (human): 5030Help
Entry
5030              CDS       T01001                                 

Gene name
P2RY4, NRU, P2P, P2Y4, UNR
Definition
(RefSeq) pyrimidinergic receptor P2Y4
  KO
K04271  
purinergic receptor P2Y, G protein-coupled, 4
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5030 (P2RY4)
 Organismal Systems
  Sensory system
   04742 Taste transduction
    5030 (P2RY4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    5030 (P2RY4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq13
AA seq 365 aa AA seqDB search
MASTESSLLRSLGLSPGPGSSEVELDCWFDEDFKFILLPVSYAVVFVLGLGLNAPTLWLF
IFRLRPWDATATYMFHLALSDTLYVLSLPTLIYYYAAHNHWPFGTEICKFVRFLFYWNLY
CSVLFLTCISVHRYLGICHPLRALRWGRPRLAGLLCLAVWLVVAGCLVPNLFFVTTSNKG
TTVLCHDTTRPEEFDHYVHFSSAVMGLLFGVPCLVTLVCYGLMARRLYQPLPGSAQSSSR
LRSLRTIAVVLTVFAVCFVPFHITRTIYYLARLLEADCRVLNIVNVVYKVTRPLASANSC
LDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTP
RADRL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggccagtacagagtcctccctgttgagatccctaggcctcagcccaggtcctggcagc
agtgaggtggagctggactgttggtttgatgaggatttcaagttcatcctgctgcctgtg
agctatgcagttgtctttgtgctgggcttgggccttaacgccccaaccctatggctcttc
atcttccgcctccgaccctgggatgcaacggccacctacatgttccacctggcattgtca
gacaccttgtatgtgctgtcgctgcccaccctcatctactattatgcagcccacaaccac
tggccctttggcactgagatctgcaagttcgtccgctttcttttctattggaacctctac
tgcagtgtccttttcctcacctgcatcagcgtgcaccgctacctgggcatctgccaccca
cttcgggcactacgctggggccgccctcgcctcgcaggccttctctgcctggcagtttgg
ttggtcgtagccggctgcctcgtgcccaacctgttctttgtcacaaccagcaacaaaggg
accaccgtcctgtgccatgacaccactcggcctgaagagtttgaccactatgtgcacttc
agctcggcggtcatggggctgctctttggcgtgccctgcctggtcactcttgtttgctat
ggactcatggctcgtcgcctgtatcagcccttgccaggctctgcacagtcgtcttctcgc
ctccgctctctccgcaccatagctgtggtgctgactgtctttgctgtctgcttcgtgcct
ttccacatcacccgcaccatttactacctggccaggctgttggaagctgactgccgagta
ctgaacattgtcaacgtggtctataaagtgactcggcccctggccagtgccaacagctgc
ctggatcctgtgctctacttgctcactggggacaaatatcgacgtcagctccgtcagctc
tgtggtggtggcaagccccagccccgcacggctgcctcttccctggcactagtgtccctg
cctgaggatagcagctgcaggtgggcggccaccccccaggacagtagctgctctactcct
agggcagatagattgtaa

DBGET integrated database retrieval system