KEGG   Homo sapiens (human): 5031Help
Entry
5031              CDS       T01001                                 

Gene name
P2RY6, P2Y6
Definition
(RefSeq) pyrimidinergic receptor P2Y6
  KO
K04272  
purinergic receptor P2Y, G protein-coupled, 6
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5031 (P2RY6)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    5031 (P2RY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.4
AA seq 328 aa AA seqDB search
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTR
TAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCI
SFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDL
SPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARM
AVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL
FYFTQKKFRRRPHELLQKLTAKWQRQGR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggacaatggcacaggccaggctctgggcttgccacccaccacctgtgtctac
cgcgagaacttcaagcaactgctgctgccacctgtgtattcggcggtgctggcggctggc
ctgccgctgaacatctgtgtcattacccagatctgcacgtcccgccgggccctgacccgc
acggccgtgtacaccctaaaccttgctctggctgacctgctatatgcctgctccctgccc
ctgctcatctacaactatgcccaaggtgatcactggccctttggcgacttcgcctgccgc
ctggtccgcttcctcttctatgccaacctgcacggcagcatcctcttcctcacctgcatc
agcttccagcgctacctgggcatctgccacccgctggccccctggcacaaacgtgggggc
cgccgggctgcctggctagtgtgtgtagccgtgtggctggccgtgacaacccagtgcctg
cccacagccatcttcgctgccacaggcatccagcgtaaccgcactgtctgctatgacctc
agcccgcctgccctggccacccactatatgccctatggcatggctctcactgtcatcggc
ttcctgctgccctttgctgccctgctggcctgctactgtctcctggcctgccgcctgtgc
cgccaggatggcccggcagagcctgtggcccaggagcggcgtggcaaggcggcccgcatg
gccgtggtggtggctgctgcctttgccatcagcttcctgccttttcacatcaccaagaca
gcctacctggcagtgcgctcgacgccgggcgtcccctgcactgtattggaggcctttgca
gcggcctacaaaggcacgcggccgtttgccagtgccaacagcgtgctggaccccatcctc
ttctacttcacccagaagaagttccgccggcgaccacatgagctcctacagaaactcaca
gccaaatggcagaggcagggtcgctga

DBGET integrated database retrieval system