KEGG   Homo sapiens (human): 5033Help
Entry
5033              CDS       T01001                                 

Gene name
P4HA1, P4HA
Definition
(RefSeq) prolyl 4-hydroxylase subunit alpha 1
  KO
K00472  
prolyl 4-hydroxylase [EC:1.14.11.2]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Drug target
Lufironil: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    5033 (P4HA1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.2  procollagen-proline dioxygenase
     5033 (P4HA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P13674(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
10q22.1
AA seq 534 aa AA seqDB search
MIWYILIIGILLPQSLAHPGFFTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWA
EKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQY
FPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDCFELGKVAYTEADY
YHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQR
ANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKM
TPRRQKKLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRL
SRATVHDPETGKLTTAQYRVSKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANY
GVGGQYEPHFDFARKDEPDAFKELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKG
TAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWLHERGQEFRRPCTLSELE
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatctggtatatattaattataggaattctgcttccccagtctttggctcatccaggc
ttttttacttcaattggtcagatgactgatttgatccatactgagaaagatctggtgact
tctctgaaagattatattaaggcagaagaggacaagttagaacaaataaaaaaatgggca
gagaagttagatcggctaactagtacagcgacaaaagatccagaaggatttgttgggcat
ccagtaaatgcattcaaattaatgaaacgtctgaatactgagtggagtgagttggagaat
ctggtccttaaggatatgtcagatggctttatctctaacctaaccattcagagacagtac
tttcctaatgatgaagatcaggttggggcagccaaagctctgttacgtctccaggatacc
tacaatttggatacagataccatctcaaagggtaatcttccaggagtgaaacacaaatct
tttctaacggctgaggactgctttgagttgggcaaagtggcctatacagaagcagattat
taccatacggaactgtggatggaacaagccctaaggcaactggatgaaggcgagatttct
accatagataaagtctctgttctagattatttgagctatgcggtatatcagcagggagac
ctggataaggcacttttgctcacaaagaagcttcttgaactagatcctgaacatcagaga
gctaatggtaacttaaaatattttgagtatataatggctaaagaaaaagatgtcaataag
tctgcttcagatgaccaatctgatcagaaaactacaccaaagaaaaaaggggttgctgtg
gattacctgccagagagacagaagtacgaaatgctgtgccgtggggagggtatcaaaatg
acccctcggagacagaaaaaactcttttgccgctaccatgatggaaaccgtaatcctaaa
tttattctggctccagctaaacaggaggatgaatgggacaagcctcgtattattcgcttc
catgatattatttctgatgcagaaattgaaatcgtcaaagacctagcaaaaccaaggctg
agccgagctacagtacatgaccctgagactggaaaattgaccacagcacagtacagagta
tctaagagtgcctggctctctggctatgaaaatcctgtggtgtctcgaattaatatgaga
atacaagatctaacaggactagatgtttccacagcagaggaattacaggtagcaaattat
ggagttggaggacagtatgaaccccattttgactttgcacggaaagatgagccagatgct
ttcaaagagctggggacaggaaatagaattgctacatggctgttttatatgagtgatgtg
tctgcaggaggagccactgtttttcctgaagttggagctagtgtttggcccaaaaaagga
actgctgttttctggtataatctgtttgccagtggagaaggagattatagtacacggcat
gcagcctgtccagtgctagttggcaacaaatgggtatccaataaatggctccatgaacgt
ggacaagaatttcgaagaccttgtacgttgtcagaattggaatga

DBGET integrated database retrieval system