KEGG   Homo sapiens (human): 5036Help
Entry
5036              CDS       T01001                                 

Gene name
PA2G4, EBP1, HG4-1, p38-2G4
Definition
(RefSeq) proliferation-associated 2G4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.2
AA seq 394 aa AA seqDB search
MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEET
GKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIAN
VAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCT
PIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDA
GQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHE
LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQS
SASRKTQKKKKKKASKTAENATSGETLEENEAGD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcgaggacgagcaacaggagcaaactatcgctgaggacctggtcgtgaccaag
tataagatggggggcgacatcgccaacagggtacttcggtccttggtggaagcatctagc
tcaggtgtgtcggtactgagcctgtgtgagaaaggtgatgccatgattatggaagaaaca
gggaaaatcttcaagaaagaaaaggaaatgaagaaaggtattgcttttcccaccagcatt
tcggtaaataactgtgtatgtcacttctcccctttgaagagcgaccaggattatattctc
aaggaaggtgacttggtaaaaattgaccttggggtccatgtggatggcttcatcgctaat
gtagctcacacttttgtggttgatgtagctcaggggacccaagtaacagggaggaaagca
gatgttattaaggcagctcacctttgtgctgaagctgccctacgcctggtcaaacctgga
aatcagaacacacaagtgacagaagcctggaacaaagttgcccactcatttaactgcacg
ccaatagaaggtatgctgtcacaccagttgaagcagcatgtcatcgatggagaaaaaacc
attatccagaatcccacagaccagcagaagaaggaccatgaaaaagctgaatttgaggta
catgaagtatatgctgtggatgttctcgtcagctcaggagagggcaaggccaaggatgca
ggacagagaaccactatttacaaacgagacccctctaaacagtatggactgaaaatgaaa
acttcacgtgccttcttcagtgaggtggaaaggcgttttgatgccatgccgtttacttta
agagcatttgaagatgagaagaaggctcggatgggtgtggtggagtgcgccaaacatgaa
ctgctgcaaccatttaatgttctctatgagaaggagggtgaatttgttgcccagtttaaa
tttacagttctgctcatgcccaatggccccatgcggataaccagtggtcccttcgagcct
gacctctacaagtctgagatggaggtccaggatgcagagctaaaggccctcctccagagt
tctgcaagtcgaaaaacccagaaaaagaaaaaaaagaaggcctccaagactgcagagaat
gccaccagtggggaaacattagaagaaaatgaagctggggactga

DBGET integrated database retrieval system