KEGG   Homo sapiens (human): 504189Help
Entry
504189            CDS       T01001                                 

Gene name
OR8U8
Definition
olfactory receptor, family 8, subfamily U, member 8
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Position
11q11
AA seq 319 aa AA seqDB search
MAHINCTQATEFILVGLTDRQELKMPLFVLFLSIYLFTVVGNLGLILLIRADTSLNTPMY
FFLSNLAFVDFCYSSVITPKMLGNFLYKQNVISFDACATQLGCFLTFMISESLLLASMAY
DRYVAICNPLLYMVVMTPGICIQLVAVPYSYSFLMALFHTILTFCLSYCHSNIVNHFYCD
DMPLLRLTCSDTRFKQLWILACAGITFICSVLIVFVSYMFIIFAILRMSSAEGRRKAFST
CSSHMLAVTIFYGTLIFMYLQPSSSHSLDADKMASVFYTVIIPMLNPLIYSLRNKDVKDA
LKKVIINRNHAFIFLKLRK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggctcacatcaattgcacccaggcgacagagtttattcttgtgggcctcacagatcgt
caggagttgaagatgcccctctttgtgctattcttatccatctacctcttcacagtggta
ggcaacttgggtttgatcctactcattagagcggatacaagtctcaacacaccaatgtac
ttctttcttagcaacctagcttttgtggatttctgttactcttctgtcattacacccaaa
atgcttgggaatttcttgtacaaacaaaatgttatatcctttgatgcatgtgctactcaa
ctgggctgctttctcaccttcatgatatcagaatccttgctactggcttccatggcctat
gaccgatatgtggccatttgtaaccctctattgtatatggttgtaatgactccaggaatc
tgcattcaacttgtagcagttccttatagctatagcttcctaatggcactatttcacacc
atcctcaccttctgcctctcctattgccactccaacattgtcaaccatttctattgtgat
gacatgcctctcctcaggctaacttgctcagacactcgcttcaaacagctatggattttg
gcctgtgctggtatcacattcatctgctctgttctgattgtctttgtctcctacatgttc
attatttttgccatcctgaggatgagctcagctgaaggaagacgcaaagccttctccacc
tgtagctctcacatgctggcagtcaccatattctatggcaccctgatctttatgtactta
caaccaagctcaagccattctcttgatgcagacaagatggcctctgtcttctacacggtg
attattcccatgttgaatcccttgatttacagtctcaggaacaaagatgtaaaagatgcc
ctgaagaaagtcatcatcaatagaaaccatgcttttatttttctgaaactgagaaaatga

DBGET integrated database retrieval system