KEGG   Homo sapiens (human): 5046Help
Entry
5046              CDS       T01001                                 

Gene name
PCSK6, PACE4, SPC4
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 6
  KO
K08672  
proprotein convertase subtilisin/kexin type 6 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     5046 (PCSK6)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S8: subtilisin family
   5046 (PCSK6)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Subtilisin family
   5046 (PCSK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q26.3
AA seq 969 aa AA seqDB search
MPPRAPPAPGPRPPPRAAAATDTAAGAGGAGGAGGAGGPGFRPLAPRPWRWLLLLALPAA
CSAPPPRPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTL
SSRGPHTFLRMDPQVKWLQQQEVKRRVKRQVRSDPQALYFNDPIWSNMWYLHCGDKNSRC
RSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDPSPRYDA
SNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKSLGIRPNYID
IYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDYCSCDGY
TNSIYTISVSSATENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTS
VSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHFYGFGL
VDAEALVVEAKKWTAVPSQHMCVAASDKRPRSIPLVQVLRTTALTSACAEHSDQRVVYLE
HVVVRTSISHPRRGDLQIYLVSPSGTKSQLLAKRLLDLSNEGFTNWEFMTVHCWGEKAEG
QWTLEIQDLPSQVRNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLELSAPELEPP
KAALSPSQVEVPEDEEDYTAQSTPGSANILQTSVCHPECGDKGCDGPNADQCLNCVHFSL
GSVKTSRKCVSVCPLGYFGDTAARRCRRCHKGCETCSSRAATQCLSCRRGFYHHQEMNTC
VTLCPAGFYADESQKNCLKCHPSCKKCVDEPEKCTVCKEGFSLARGSCIPDCEPGTYFDS
ELIRCGECHHTCGTCVGPGREECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRR
CDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQF
CCRTCLLAG
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgcgcgcgccgcctgcgcccgggccccggccgccgccccgggccgccgccgcc
accgacaccgccgcgggcgcggggggcgcggggggcgcggggggcgccggcgggcccggg
ttccggccgctcgcgccgcgtccctggcgctggctgctgctgctggcgctgcctgccgcc
tgctccgcgcccccgccgcgccccgtctacaccaaccactgggcggtgcaagtgctgggc
ggcccggccgaggcggaccgcgtggcggcggcgcacgggtacctcaacttgggccagatt
ggaaacctggaagattactaccatttttatcacagcaaaacctttaaaagatcaaccttg
agtagcagaggccctcacaccttcctcagaatggacccccaggtgaaatggctccagcaa
caggaagtgaaacgaagggtgaagagacaggtgcgaagtgacccgcaggccctttacttc
aacgaccccatttggtccaacatgtggtacctgcattgtggcgacaagaacagtcgctgc
cggtcggaaatgaatgtccaggcagcgtggaagaggggctacacaggaaaaaacgtggtg
gtcaccatccttgatgatggcatagagagaaatcaccctgacctggccccaaattatgat
tcctacgccagctacgacgtgaacggcaatgattatgacccatctccacgatatgatgcc
agcaatgaaaataaacacggcactcgttgtgcgggagaagttgctgcttcagcaaacaat
tcctactgcatcgtgggcatagcgtacaatgccaaaataggaggcatccgcatgctggac
ggcgatgtcacagatgtggtcgaggcaaagtcgctgggcatcagacccaactacatcgac
atttacagtgccagctgggggccggacgacgacggcaagacggtggacgggcccggccga
ctggctaagcaggctttcgagtatggcattaaaaagggccggcagggcctgggctccatt
ttcgtctgggcatctgggaatggcgggagagagggggactactgctcgtgcgatggctac
accaacagcatctacaccatctccgtcagcagcgccaccgagaatggctacaagccctgg
tacctggaagagtgtgcctccaccctggccaccacctacagcagtggggccttttatgag
cgaaaaatcgtcaccacggatctgcgtcagcgctgtaccgatggccacactgggacctca
gtctctgcccccatggtggcgggcatcatcgccttggctctagaagcaaacagccagtta
acctggagggacgtccagcacctgctagtgaagacatcccggccggcccacctgaaagcg
agcgactggaaagtgaacggcgcgggtcataaagttagccatttctatggatttggtttg
gtggacgcagaagctctcgttgtggaggcaaagaagtggacagcagtgccatcgcagcac
atgtgtgtggccgcctcggacaagagacccaggagcatccccttagtgcaggtgctgcgg
actacggccctgaccagcgcctgcgcggagcactcggaccagcgggtggtctacttggag
cacgtggtggttcgcacctccatctcacacccacgccgaggagacctccagatctacctg
gtttctccctcgggaaccaagtctcaacttctggcaaagaggttgctggatctttccaat
gaagggtttacaaactgggaattcatgactgtccactgctggggagaaaaggctgaaggg
cagtggaccttggaaatccaagatctgccatcccaggtccgcaacccggagaagcaaggg
aagttgaaagaatggagcctcatactgtatggcacagcagagcacccgtaccacaccttc
agtgcccatcagtcccgctcgcggatgctggagctctcagccccagagctggagccaccc
aaggctgccctgtcaccctcccaggtggaagttcctgaagatgaggaagattacacagct
caatccaccccaggctctgctaatattttacagaccagtgtgtgccatccggagtgtggt
gacaaaggctgtgatggccccaatgcagaccagtgcttgaactgcgtccacttcagcctg
gggagtgtcaagaccagcaggaagtgcgtgagtgtgtgccccttgggctactttggggac
acagcagcaagacgctgtcgccggtgccacaaggggtgtgagacctgctccagcagagct
gcgacgcagtgcctgtcttgccgccgcgggttctatcaccaccaggagatgaacacctgt
gtgaccctctgtcctgcaggattttatgctgatgaaagtcagaaaaattgccttaaatgc
cacccaagctgtaaaaagtgcgtggatgaacctgagaaatgtactgtctgtaaagaagga
ttcagccttgcacggggcagctgcattcctgactgtgagccaggcacctactttgactca
gagctgatcagatgtggggaatgccatcacacctgcggaacctgcgtggggccaggcaga
gaagagtgcattcactgtgcgaaaaacttccacttccacgactggaagtgtgtgccagcc
tgtggtgagggcttctacccagaagagatgccgggcttgccccacaaagtgtgtcgaagg
tgtgacgagaactgcttgagctgtgcaggctccagcaggaactgtagcaggtgtaagacg
ggcttcacacagctggggacctcctgcatcaccaaccacacgtgcagcaacgctgacgag
acattctgcgagatggtgaagtccaaccggctgtgcgaacggaagctcttcattcagttc
tgctgccgcacgtgcctcctggccgggtaa

DBGET integrated database retrieval system