KEGG   Homo sapiens (human): 50484Help
Entry
50484             CDS       T01001                                 

Gene name
RRM2B, MTDPS8A, MTDPS8B, P53R2
Definition
ribonucleotide reductase M2 B (TP53 inducible) (EC:1.17.4.1)
Orthology
K10808  
ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Glutathione metabolism
Metabolic pathways
p53 signaling pathway
Disease
H00469  
Mitochondrial DNA depletion syndrome (MDS)
H01118  
Progressive external ophthalmoplegia (PEO)
Drug target
Clofarabine: 
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:hsa00480]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q23.1
AA seq 423 aa AA seqDB search
MLLLRLPPHRSHASPLDCKLQDRCRKCYSPRSGQACPPALAAAWLRRCERRGGRPRGGRR
KELTLGLRPARCSAPGPAKDDAWRPQAGRSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQ
YPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLV
ERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKK
ADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDE
GLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEF
VADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLD
ADF
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgttgcgtcttccccctcaccgcagtcacgccagcccgttagattgcaagttg
caggaccgctgtaggaaatgttattcgccgcggtcaggacaggcctgtccgcccgccctc
gccgcagcctggcttcgtcgttgcgagcgccggggaggccgtccccggggagggcggagg
aaggagctgactttgggtttgcgtcccgctcgctgctctgccccggggccagccaaggac
gacgcttggaggcctcaggccgggagatcatcttcagacaccaacgaaagtgaaataaag
tcaaatgaagagccactcctaagaaagagttctcgccggtttgtcatctttccaatccag
taccctgatatttggaaaatgtataaacaggcacaggcttccttctggacagcagaagag
gtcgacttatcaaaggatctccctcactggaacaagcttaaagcagatgagaagtacttc
atctctcacatcttagccttttttgcagccagtgatggaattgtaaatgaaaatttggtg
gagcgctttagtcaggaggtgcaggttccagaggctcgctgtttctatggctttcaaatt
ctcatcgagaatgttcactcagagatgtacagtttgctgatagacacttacatcagagat
cccaagaaaagggaatttttatttaatgcaattgaaaccatgccctatgttaagaaaaaa
gcagattgggccttgcgatggatagcagatagaaaatctacttttggggaaagagtggtg
gcctttgctgctgtagaaggagttttcttctcaggatcttttgctgctatattctggcta
aagaagagaggtcttatgccaggactcactttttccaatgaactcatcagcagagatgaa
ggacttcactgtgactttgcttgcctgatgttccaatacttagtaaataagccttcagaa
gaaagggtcagggagatcattgttgatgctgtcaaaattgagcaggagtttttaacagaa
gccttgccagttggcctcattggaatgaattgcattttgatgaaacagtacattgagttt
gtagctgacagattacttgtggaacttggattctcaaaggtttttcaggcagaaaatcct
tttgattttatggaaaacatttctttagaaggaaaaacaaatttctttgagaaacgagtt
tcagagtatcagcgttttgcagttatggcagaaaccacagataacgtcttcaccttggat
gcagatttttaa

DBGET integrated database retrieval system