KEGG   Homo sapiens (human): 50484Help
Entry
50484             CDS       T01001                                 

Gene name
RRM2B, MTDPS8A, MTDPS8B, P53R2
Definition
(RefSeq) ribonucleotide reductase regulatory TP53 inducible subunit M2B (EC:1.17.4.1)
  KO
K10808  
ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Glutathione metabolism
Metabolic pathways
p53 signaling pathway
Disease
H00469  
Mitochondrial DNA depletion syndrome (MDS)
H01118  
Progressive external ophthalmoplegia (PEO)
H01390  
Mitochondrial neurogastrointestinal encephalomyopathy
Drug target
Clofarabine: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    50484 (RRM2B)
   00240 Pyrimidine metabolism
    50484 (RRM2B)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    50484 (RRM2B)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    50484 (RRM2B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     50484 (RRM2B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    50484 (RRM2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q23.1
AA seq 351 aa AA seqDB search
MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQ
ASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEA
RCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRK
STFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ
YLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFS
KVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDADF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacccggaaaggccggaagcggccgggctggatcaggatgagagatcatcttca
gacaccaacgaaagtgaaataaagtcaaatgaagagccactcctaagaaagagttctcgc
cggtttgtcatctttccaatccagtaccctgatatttggaaaatgtataaacaggcacag
gcttccttctggacagcagaagaggtcgacttatcaaaggatctccctcactggaacaag
cttaaagcagatgagaagtacttcatctctcacatcttagccttttttgcagccagtgat
ggaattgtaaatgaaaatttggtggagcgctttagtcaggaggtgcaggttccagaggct
cgctgtttctatggctttcaaattctcatcgagaatgttcactcagagatgtacagtttg
ctgatagacacttacatcagagatcccaagaaaagggaatttttatttaatgcaattgaa
accatgccctatgttaagaaaaaagcagattgggccttgcgatggatagcagatagaaaa
tctacttttggggaaagagtggtggcctttgctgctgtagaaggagttttcttctcagga
tcttttgctgctatattctggctaaagaagagaggtcttatgccaggactcactttttcc
aatgaactcatcagcagagatgaaggacttcactgtgactttgcttgcctgatgttccaa
tacttagtaaataagccttcagaagaaagggtcagggagatcattgttgatgctgtcaaa
attgagcaggagtttttaacagaagccttgccagttggcctcattggaatgaattgcatt
ttgatgaaacagtacattgagtttgtagctgacagattacttgtggaacttggattctca
aaggtttttcaggcagaaaatccttttgattttatggaaaacatttctttagaaggaaaa
acaaatttctttgagaaacgagtttcagagtatcagcgttttgcagttatggcagaaacc
acagataacgtcttcaccttggatgcagatttttaa

DBGET integrated database retrieval system