KEGG   Homo sapiens (human): 50507Help
Entry
50507             CDS       T01001                                 

Gene name
NOX4, KOX, KOX-1, RENOX
Definition
(RefSeq) NADPH oxidase 4
  KO
K21423  
NADPH oxidase 4 [EC:1.6.3.-]
Organism
hsa  Homo sapiens (human)
Pathway
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    50507 (NOX4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.-  
     50507 (NOX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NPH5(Tchem)
UniProt: 
Position
11q14.3
AA seq 578 aa AA seqDB search
MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRAS
ASVLNLNCSLILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHV
AAHLVNALNFSVNYSEDFVELNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTY
AIRVSNYDIFWYTHNLFFVFYMLLTLHVSGGLLKYQTNLDTHPPGCISLNRTSSQNISLP
EYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLY
RYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCP
TETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEES
LNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLH
NKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGK
TVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgtcctggaggagctggctcgccaacgaaggggttaaacacctctgcctgttc
atctggctctccatgaatgtcctgcttttctggaaaaccttcttgctgtataaccaaggg
ccagagtatcactacctccaccagatgttggggctaggattgtgtctaagcagagcctca
gcatctgttcttaacctcaactgcagccttatccttttacccatgtgccgaacactcttg
gcttacctccgaggatcacagaaggttccaagcaggagaaccaggagattgttggataaa
agcagaacattccatattacctgtggtgttactatctgtattttctcaggcgtgcatgtg
gctgcccatctggtgaatgccctcaacttctcagtgaattacagtgaagactttgttgaa
ctgaatgcagcaagataccgagatgaggatcctagaaaacttctcttcacaactgttcct
ggcctgacaggggtctgcatggtggtggtgctattcctcatgatcacagcctctacatat
gcaataagagtttctaactatgatatcttctggtatactcataacctcttctttgtcttc
tacatgctgctgacgttgcatgtttcaggagggctgctgaagtatcaaactaatttagat
acccaccctcccggctgcatcagtcttaaccgaaccagctctcagaatatttccttacca
gagtatttctcagaacattttcatgaacctttccctgaaggattttcaaaaccggcagag
tttacccagcacaaatttgtgaagatttgtatggaagagcccagattccaagctaatttt
ccacagacttggctttggatttctggacctttgtgcctgtactgtgccgaaagactttac
aggtatatccggagcaataagccagtcaccatcatttcggtcataagtcatccctcagat
gtcatggaaatccgaatggtcaaagaaaattttaaagcaagacctggtcagtatattact
ctacattgtcccagtgtatctgcattagaaaatcatccatttaccctcacaatgtgtcca
actgaaaccaaagcaacatttggggttcatcttaaaatagtaggagactggacagaacga
tttcgagatttactactgcctccatctagtcaagactccgaaattctgcccttcattcaa
tctagaaattatcccaagctgtatattgatggtccttttggaagtccatttgaggaatca
ctgaactatgaggtcagcctctgcgtggctggaggcattggagtaactccatttgcatca
atactcaacaccctgttggatgactggaaaccatacaagcttagaagactatactttatt
tgggtatgcagagatatccagtccttccgttggtttgcagatttactctgtatgttgcat
aacaagttttggcaagagaacagacctgactatgtcaacatccagctgtacctcagtcaa
acagatgggatacagaagataattggagaaaaatatcatgcactgaattcaagactgttt
ataggacgtcctcggtggaaacttttgtttgatgaaatagcaaaatataacagaggaaaa
acagttggtgttttctgttgtggacccaattcactatccaagactcttcataaactgagt
aaccagaacaactcatatgggacaagatttgaatacaataaagagtctttcagctga

DBGET integrated database retrieval system