KEGG   Homo sapiens (human): 50507Help
Entry
50507             CDS       T01001                                 

Gene name
NOX4, KOX, KOX-1, RENOX
Definition
(RefSeq) NADPH oxidase 4 (EC:1.6.3.-)
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q14.2-q21
AA seq 578 aa AA seqDB search
MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRAS
ASVLNLNCSLILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHV
AAHLVNALNFSVNYSEDFVELNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTY
AIRVSNYDIFWYTHNLFFVFYMLLTLHVSGGLLKYQTNLDTHPPGCISLNRTSSQNISLP
EYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLY
RYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCP
TETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEES
LNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLH
NKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGK
TVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgtcctggaggagctggctcgccaacgaaggggttaaacacctctgcctgttc
atctggctctccatgaatgtcctgcttttctggaaaaccttcttgctgtataaccaaggg
ccagagtatcactacctccaccagatgttggggctaggattgtgtctaagcagagcctca
gcatctgttcttaacctcaactgcagccttatccttttacccatgtgccgaacactcttg
gcttacctccgaggatcacagaaggttccaagcaggagaaccaggagattgttggataaa
agcagaacattccatattacctgtggtgttactatctgtattttctcaggcgtgcatgtg
gctgcccatctggtgaatgccctcaacttctcagtgaattacagtgaagactttgttgaa
ctgaatgcagcaagataccgagatgaggatcctagaaaacttctcttcacaactgttcct
ggcctgacaggggtctgcatggtggtggtgctattcctcatgatcacagcctctacatat
gcaataagagtttctaactatgatatcttctggtatactcataacctcttctttgtcttc
tacatgctgctgacgttgcatgtttcaggagggctgctgaagtatcaaactaatttagat
acccaccctcccggctgcatcagtcttaaccgaaccagctctcagaatatttccttacca
gagtatttctcagaacattttcatgaacctttccctgaaggattttcaaaaccggcagag
tttacccagcacaaatttgtgaagatttgtatggaagagcccagattccaagctaatttt
ccacagacttggctttggatttctggacctttgtgcctgtactgtgccgaaagactttac
aggtatatccggagcaataagccagtcaccatcatttcggtcataagtcatccctcagat
gtcatggaaatccgaatggtcaaagaaaattttaaagcaagacctggtcagtatattact
ctacattgtcccagtgtatctgcattagaaaatcatccatttaccctcacaatgtgtcca
actgaaaccaaagcaacatttggggttcatcttaaaatagtaggagactggacagaacga
tttcgagatttactactgcctccatctagtcaagactccgaaattctgcccttcattcaa
tctagaaattatcccaagctgtatattgatggtccttttggaagtccatttgaggaatca
ctgaactatgaggtcagcctctgcgtggctggaggcattggagtaactccatttgcatca
atactcaacaccctgttggatgactggaaaccatacaagcttagaagactatactttatt
tgggtatgcagagatatccagtccttccgttggtttgcagatttactctgtatgttgcat
aacaagttttggcaagagaacagacctgactatgtcaacatccagctgtacctcagtcaa
acagatgggatacagaagataattggagaaaaatatcatgcactgaattcaagactgttt
ataggacgtcctcggtggaaacttttgtttgatgaaatagcaaaatataacagaggaaaa
acagttggtgttttctgttgtggacccaattcactatccaagactcttcataaactgagt
aaccagaacaactcatatgggacaagatttgaatacaataaagagtctttcagctga

DBGET integrated database retrieval system