KEGG   Homo sapiens (human): 50509Help
Entry
50509             CDS       T01001                                 

Gene name
COL5A3
Definition
(RefSeq) collagen type V alpha 3
  KO
K19721  
collagen, type V/XI/XXIV/XXVII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    50509 (COL5A3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   50509 (COL5A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 1745 aa AA seqDB search
MGNRRDLGQPRAGLCLLLAALQLLPGTQADPVDVLKALGVQGGQAGVPEGPGFCPQRTPE
GDRAFRIGQASTLGIPTWELFPEGHFPENFSLLITLRGQPANQSVLLSIYDERGARQLGL
ALGPALGLLGDPFRPLPQQVNLTDGRWHRVAVSIDGEMVTLVADCEAQPPVLGHGPRFIS
IAGLTVLGTQDLGEKTFEGDIQELLISPDPQAAFQACERYLPDCDNLAPAATVAPQGEPE
TPRPRRKGKGKGRKKGRGRKGKGRKKNKEIWTSSPPPDSAENQTSTDIPKTETPAPNLPP
TPTPLVVTSTVTTGLNATILERSLDPDSGTELGTLETKAAREDEEGDDSTMGPDFRAAEY
PSRTQFQIFPGAGEKGAKGEPAVIEKGQQFEGPPGAPGPQGVVGPSGPPGPPGFPGDPGP
PGPAGLPGIPGIDGIRGPPGTVIMMPFQFAGGSFKGPPVSFQQAQAQAVLQQTQLSMKGP
PGPVGLTGRPGPVGLPGHPGLKGEEGAEGPQGPRGLQGPHGPPGRVGKMGRPGADGARGL
PGDTGPKGDRGFDGLPGLPGEKGQRGDFGHVGQPGPPGEDGERGAEGPPGPTGQAGEPGP
RGLLGPRGSPGPTGRPGVTGIDGAPGAKGNVGPPGEPGPPGQQGNHGSQGLPGPQGLIGT
PGEKGPPGNPGIPGLPGSDGPLGHPGHEGPTGEKGAQGPPGSAGPPGYPGPRGVKGTSGN
RGLQGEKGEKGEDGFPGFKGDVGLKGDQGKPGAPGPRGEDGPEGPKGQAGQAGEEGPPGS
AGEKGKLGVPGLPGYPGRPGPKGSIGFPGPLGPIGEKGKSGKTGQPGLEGERGPPGSRGE
RGQPGATGQPGPKGDVGQDGAPGIPGEKGLPGLQGPPGFPGPKGPPGHQGKDGRPGHPGQ
RGELGFQGQTGPPGPAGVLGPQGKTGEVGPLGERGPPGPPGPPGEQGLPGLEGREGAKGE
LGPPGPLGKEGPAGLRGFPGPKGGPGDPGPTGLKGDKGPPGPVGANGSPGERGPLGPAGG
IGLPGQSGSEGPVGPAGKKGSRGERGPPGPTGKDGIPGPLGPLGPPGAAGPSGEEGDKGD
VGAPGHKGSKGDKGDAGPPGQPGIRGPAGHPGPPGADGAQGRRGPPGLFGQKGDDGVRGF
VGVIGPPGLQGLPGPPGEKGEVGDVGSMGPHGAPGPRGPQGPTGSEGTPGLPGGVGQPGA
VGEKGERGDAGDPGPPGAPGIPGPKGDIGEKGDSGPSGAAGPPGKKGPPGEDGAKGSVGP
TGLPGDLGPPGDPGVSGIDGSPGEKGDPGDVGGPGPPGASGEPGAPGPPGKRGPSGHMGR
EGREGEKGAKGEPGPDGPPGRTGPMGARGPPGRVGPEGLRGIPGPVGEPGLLGAPGQMGP
PGPLGPSGLPGLKGDTGPKGEKGHIGLIGLIGPPGEAGEKGDQGLPGVQGPPGPKGDPGP
PGPIGSLGHPGPPGVAGPLGQKGSKGSPGSMGPRGDTGPAGPPGPPGAPAELHGLRRRRR
FVPVPLPVVEGGLEEVLASLTSLSLELEQLRRPPGTAERPGLVCHELHRNHPHLPDGEYW
IDPNQGCARDSFRVFCNFTAGGETCLYPDKKFEIVKLASWSKEKPGGWYSTFRRGKKFSY
VDADGSPVNVVQLNFLKLLSATARQNFTYSCQNAAAWLDEATGDYSHSARFLGTNGEELS
FNQTTAATVSVPQDGCRLRKGQTKTLFEFSSSRAGFLPLWDVAATDFGQTNQKFGFELGP
VCFSS
NT seq 5238 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccgccgggacctgggccagccgcgggccggtctctgcctgctcctggccgcg
ctgcagcttctgccggggacgcaggccgatcctgtggatgtcctgaaggccctgggtgtg
cagggaggccaggctggggtccccgaggggcctggcttctgtccccagaggactccagag
ggtgaccgggcattcagaattggccaggccagcacgctcggcatccccacgtgggaactc
tttccagaaggccactttcctgagaacttctccttgctgatcaccttgcggggacagcca
gccaatcagtctgtcctgctgtccatttatgatgaaaggggtgcccggcagttgggcctg
gcactggggccagcgctgggtctcctaggtgaccccttccgccccctcccccagcaggtc
aacctcacagatggcaggtggcaccgtgtggccgtcagcatagatggtgagatggtgacc
ctggtagctgactgtgaagctcagccccctgttttgggccatggcccccgcttcatcagc
atagctggactcactgtgctggggacccaggaccttggggaaaagactttcgagggagac
attcaggagctgctgataagcccagatcctcaggctgccttccaggcttgtgagcggtac
ctccccgactgtgacaacctggcaccggcagccacagtggctccccagggtgaaccagaa
acccctcgtcctcggcggaaggggaagggaaaagggaggaagaaagggcgaggtcgcaag
gggaagggcaggaaaaagaacaaggaaatttggacctcaagtccacctcctgactccgca
gagaaccagacctccactgacatccccaagacagagactccagctccaaatctgcctccg
acccccacgcctttggtcgtcacctccactgtgactactggactcaatgccacgatccta
gagaggagcttggaccctgacagtggaaccgagctggggaccctggagaccaaggcagcc
agggaggatgaagaaggagatgattccaccatgggccctgacttccgggcagcagaatat
ccatctcggactcagttccagatctttcctggtgctggagagaaaggagcaaaaggagag
cccgcagtgattgaaaaggggcagcagtttgagggacctccaggagccccaggaccccaa
ggggtggttggcccctcaggccctcccggccccccaggattccctggcgaccctggtcca
ccgggccctgctggcctcccaggaatccccggcattgatgggatccgaggcccaccgggc
actgtgatcatgatgccgttccagtttgcaggcggctcctttaaaggccccccagtctca
ttccagcaggcccaggctcaggcagttctgcagcagactcagctctctatgaaaggcccc
cctggtccagtggggctcactgggcgcccaggccctgtgggtctccccgggcatccaggt
ctgaaaggagaggagggagcagaagggccacagggtccccgaggcctgcagggacctcat
ggaccccctggccgagtgggcaagatgggccgccctggagcagatggagctcggggcctc
ccaggggacactggacctaagggtgatcgtggcttcgatggcctccctgggctgcctggt
gagaagggccaaaggggtgactttggccatgtggggcaacccggtcccccaggagaggat
ggtgagaggggagcagagggacctccagggcccactggccaggctggggagccgggtcca
cgaggactgcttggccccagaggctctcctggccccacgggtcgcccgggtgtgactgga
attgatggtgctcctggtgccaaaggcaatgtgggtcctccaggagaaccaggccctccg
ggacagcagggaaaccatgggtcccagggactccccggtccccagggactcattggcact
cctggggagaagggtccccctggaaacccaggaattccaggcctcccaggatccgatggc
cctctgggtcacccaggacatgagggccccacgggagagaaaggggctcagggtccacca
gggtcggcaggccctccgggctatcctggacctcggggagtgaagggcacttcaggcaac
cggggcctccagggggagaaaggcgagaagggagaggacggcttcccaggcttcaagggc
gatgtggggctcaaaggtgatcaggggaaacccggagctccaggtccccggggagaggat
ggtcctgaggggccgaaggggcaggcggggcaggctggcgaggaggggcccccaggctca
gctggggagaagggcaagcttggggtgccaggcctcccaggttatccaggacgccctgga
cctaagggatctattggatttcccggtcccctgggacccataggagagaaagggaagtcg
ggaaagacagggcagccaggcctggaaggagagcggggaccaccaggttcccgtggagag
agggggcaaccgggtgccacagggcaaccaggccccaagggcgatgtgggccaggatgga
gcccctgggatccctggagaaaagggcctccctggtctgcaaggccctccaggattccct
gggccaaagggcccccctggtcaccaaggtaaagatgggcgaccagggcaccctggacag
agaggagaactgggcttccaaggtcagacaggcccgcctggaccagctggtgtcttaggc
cctcagggaaagacaggagaagtgggacctctaggtgaaagggggcctccaggcccccct
ggacctcctggtgaacaaggtcttcctggcctggaaggcagagagggggccaagggggaa
ctgggaccaccaggaccccttgggaaagaagggccagctggactcaggggctttcccggc
cccaaagggggccctggggacccgggacctactggcttaaagggtgataagggcccccca
gggcccgtgggggccaatggctcccctggtgagcgcggtcctttgggcccagcaggaggc
attggacttcctggccaaagtggcagcgaaggccccgttggccctgcaggcaagaagggg
tcccggggagaacgtggcccccctggccccactggcaaagatgggatcccagggcccctg
gggcctctgggaccccctggagctgctgggccttctggcgaggaaggggacaagggggat
gtgggtgcccccggacacaaggggagtaaaggcgataaaggagacgcgggcccacctgga
caaccagggatacggggtcctgcaggacacccaggtcccccgggagcagacggggctcag
gggcgccggggacccccaggcctctttgggcagaaaggagatgacggagtcagaggcttt
gtgggggtgattggccctcctggactgcaggggctgccaggccctccgggagagaaaggg
gaggtcggagacgtcgggtccatgggtccccatggagctccaggtcctcggggtccccaa
ggccccactggatcagagggcactccagggctgcctggaggagttggtcagccaggcgcc
gtgggtgagaagggtgagcgaggggacgctggagacccagggcctccaggagccccaggc
atcccggggcccaagggagacattggtgaaaagggggactcaggcccatctggagctgct
ggacccccaggcaagaaaggtccccctggagaggatggagccaaagggagcgtgggcccc
acggggctgcccggagatctagggcccccaggagaccctggagtttcaggcatagatggt
tccccaggggagaagggagaccctggtgatgttgggggaccgggtccgcctggagcttct
ggggagcccggcgcccccgggccccccggcaagaggggtccttcaggccacatgggtcga
gaaggcagagaaggggagaaaggtgccaagggggagccaggtcctgatgggcccccaggg
aggacgggtccaatgggggctagagggccccctggacgtgtggggcctgagggtcttcga
gggatccctggccctgtgggtgaaccaggcctcctgggagcccctggacagatgggccct
cctggccccctggggccctctggcctcccagggctgaagggagacactggccccaagggg
gaaaagggccacattggattgatcggtctcattggccccccgggagaagctggtgagaaa
ggagatcaggggttgccaggcgtgcagggaccccctggtcccaagggagaccctggtccc
cctggtcccattggctctctgggccaccctgggcccccaggtgtggcgggccctctagga
cagaaaggctcaaaagggtctccggggtccatgggcccccgtggagacactggacctgca
ggcccaccaggccccccgggtgcccctgccgagctgcatgggctgcgcaggcgccggcgc
ttcgtcccagtcccgcttccagtcgtggagggcggcctggaggaggtgctggcctcgctc
acatcgctgagcttggagctggagcagctgcggcgtcctcccggcactgcggagcgcccg
ggcctcgtgtgccacgagctgcaccgcaaccacccgcacctgcctgatggggaatactgg
attgaccccaaccagggctgcgcgcgggactcgttcagggttttttgcaacttcacggcg
ggaggagagacctgcctctatcccgacaagaagtttgagatcgtgaaattggcctcctgg
tccaaggaaaagcctggaggctggtatagcacattccgtcgagggaagaagttctcctac
gtggacgccgacgggtccccagtgaatgtcgtgcagctgaacttcctgaaactgctgagt
gccacagctcgccagaacttcacctactcctgccagaatgcagctgcctggctggacgaa
gccacgggtgactacagccactccgcccgcttccttggcaccaatggagaggagctgtct
ttcaaccagacgacagcagccactgtcagcgtcccccaggatggctgccggctccggaaa
ggacagacgaagacccttttcgaattcagctcttctcgagcgggatttctgcccctgtgg
gatgtggcggccactgactttggccagacgaaccaaaagtttgggtttgaactgggcccc
gtctgcttcagcagctga

DBGET integrated database retrieval system