KEGG   Homo sapiens (human): 50509Help
Entry
50509             CDS       T01001                                 

Gene name
COL5A3
Definition
collagen, type V, alpha 3
Orthology
K06236  
collagen, type I/II/III/V/XI/XXIV/XXVII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Platelet activation
Protein digestion and absorption
Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    50509 (COL5A3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    50509 (COL5A3)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    50509 (COL5A3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    50509 (COL5A3)
  Digestive system
   04974 Protein digestion and absorption
    50509 (COL5A3)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    50509 (COL5A3)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  50509 (COL5A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 1745 aa AA seqDB search
MGNRRDLGQPRAGLCLLLAALQLLPGTQADPVDVLKALGVQGGQAGVPEGPGFCPQRTPE
GDRAFRIGQASTLGIPTWELFPEGHFPENFSLLITLRGQPANQSVLLSIYDERGARQLGL
ALGPALGLLGDPFRPLPQQVNLTDGRWHRVAVSIDGEMVTLVADCEAQPPVLGHGPRFIS
IAGLTVLGTQDLGEKTFEGDIQELLISPDPQAAFQACERYLPDCDNLAPAATVAPQGEPE
TPRPRRKGKGKGRKKGRGRKGKGRKKNKEIWTSSPPPDSAENQTSTDIPKTETPAPNLPP
TPTPLVVTSTVTTGLNATILERSLDPDSGTELGTLETKAAREDEEGDDSTMGPDFRAAEY
PSRTQFQIFPGAGEKGAKGEPAVIEKGQQFEGPPGAPGPQGVVGPSGPPGPPGFPGDPGP
PGPAGLPGIPGIDGIRGPPGTVIMMPFQFAGGSFKGPPVSFQQAQAQAVLQQTQLSMKGP
PGPVGLTGRPGPVGLPGHPGLKGEEGAEGPQGPRGLQGPHGPPGRVGKMGRPGADGARGL
PGDTGPKGDRGFDGLPGLPGEKGQRGDFGHVGQPGPPGEDGERGAEGPPGPTGQAGEPGP
RGLLGPRGSPGPTGRPGVTGIDGAPGAKGNVGPPGEPGPPGQQGNHGSQGLPGPQGLIGT
PGEKGPPGNPGIPGLPGSDGPLGHPGHEGPTGEKGAQGPPGSAGPPGYPGPRGVKGTSGN
RGLQGEKGEKGEDGFPGFKGDVGLKGDQGKPGAPGPRGEDGPEGPKGQAGQAGEEGPPGS
AGEKGKLGVPGLPGYPGRPGPKGSIGFPGPLGPIGEKGKSGKTGQPGLEGERGPPGSRGE
RGQPGATGQPGPKGDVGQDGAPGIPGEKGLPGLQGPPGFPGPKGPPGHQGKDGRPGHPGQ
RGELGFQGQTGPPGPAGVLGPQGKTGEVGPLGERGPPGPPGPPGEQGLPGLEGREGAKGE
LGPPGPLGKEGPAGLRGFPGPKGGPGDPGPTGLKGDKGPPGPVGANGSPGERGPLGPAGG
IGLPGQSGSEGPVGPAGKKGSRGERGPPGPTGKDGIPGPLGPLGPPGAAGPSGEEGDKGD
VGAPGHKGSKGDKGDAGPPGQPGIRGPAGHPGPPGADGAQGRRGPPGLFGQKGDDGVRGF
VGVIGPPGLQGLPGPPGEKGEVGDVGSMGPHGAPGPRGPQGPTGSEGTPGLPGGVGQPGA
VGEKGERGDAGDPGPPGAPGIPGPKGDIGEKGDSGPSGAAGPPGKKGPPGEDGAKGSVGP
TGLPGDLGPPGDPGVSGIDGSPGEKGDPGDVGGPGPPGASGEPGAPGPPGKRGPSGHMGR
EGREGEKGAKGEPGPDGPPGRTGPMGARGPPGRVGPEGLRGIPGPVGEPGLLGAPGQMGP
PGPLGPSGLPGLKGDTGPKGEKGHIGLIGLIGPPGEAGEKGDQGLPGVQGPPGPKGDPGP
PGPIGSLGHPGPPGVAGPLGQKGSKGSPGSMGPRGDTGPAGPPGPPGAPAELHGLRRRRR
FVPVPLPVVEGGLEEVLASLTSLSLELEQLRRPPGTAERPGLVCHELHRNHPHLPDGEYW
IDPNQGCARDSFRVFCNFTAGGETCLYPDKKFEIVKLASWSKEKPGGWYSTFRRGKKFSY
VDADGSPVNVVQLNFLKLLSATARQNFTYSCQNAAAWLDEATGDYSHSARFLGTNGEELS
FNQTTAATVSVPQDGCRLRKGQTKTLFEFSSSRAGFLPLWDVAATDFGQTNQKFGFELGP
VCFSS
NT seq 5238 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccgccgggacctgggccagccgcgggccggtctctgcctgctcctggccgcg
ctgcagcttctgccggggacgcaggccgatcctgtggatgtcctgaaggccctgggtgtg
cagggaggccaggctggggtccccgaggggcctggcttctgtccccagaggactccagag
ggtgaccgggcattcagaattggccaggccagcacgctcggcatccccacgtgggaactc
tttccagaaggccactttcctgagaacttctccttgctgatcaccttgcggggacagcca
gccaatcagtctgtcctgctgtccatttatgatgaaaggggtgcccggcagttgggcctg
gcactggggccagcgctgggtctcctaggtgaccccttccgccccctcccccagcaggtc
aacctcacagatggcaggtggcaccgtgtggccgtcagcatagatggtgagatggtgacc
ctggtagctgactgtgaagctcagccccctgttttgggccatggcccccgcttcatcagc
atagctggactcactgtgctggggacccaggaccttggggaaaagactttcgagggagac
attcaggagctgctgataagcccagatcctcaggctgccttccaggcttgtgagcggtac
ctccccgactgtgacaacctggcaccggcagccacagtggctccccagggtgaaccagaa
acccctcgtcctcggcggaaggggaagggaaaagggaggaagaaagggcgaggtcgcaag
gggaagggcaggaaaaagaacaaggaaatttggacctcaagtccacctcctgactccgca
gagaaccagacctccactgacatccccaagacagagactccagctccaaatctgcctccg
acccccacgcctttggtcgtcacctccactgtgactactggactcaatgccacgatccta
gagaggagcttggaccctgacagtggaaccgagctggggaccctggagaccaaggcagcc
agggaggatgaagaaggagatgattccaccatgggccctgacttccgggcagcagaatat
ccatctcggactcagttccagatctttcctggtgctggagagaaaggagcaaaaggagag
cccgcagtgattgaaaaggggcagcagtttgagggacctccaggagccccaggaccccaa
ggggtggttggcccctcaggccctcccggccccccaggattccctggcgaccctggtcca
ccgggccctgctggcctcccaggaatccccggcattgatgggatccgaggcccaccgggc
actgtgatcatgatgccgttccagtttgcaggcggctcctttaaaggccccccagtctca
ttccagcaggcccaggctcaggcagttctgcagcagactcagctctctatgaaaggcccc
cctggtccagtggggctcactgggcgcccaggccctgtgggtctccccgggcatccaggt
ctgaaaggagaggagggagcagaagggccacagggtccccgaggcctgcagggacctcat
ggaccccctggccgagtgggcaagatgggccgccctggagcagatggagctcggggcctc
ccaggggacactggacctaagggtgatcgtggcttcgatggcctccctgggctgcctggt
gagaagggccaaaggggtgactttggccatgtggggcaacccggtcccccaggagaggat
ggtgagaggggagcagagggacctccagggcccactggccaggctggggagccgggtcca
cgaggactgcttggccccagaggctctcctggccccacgggtcgcccgggtgtgactgga
attgatggtgctcctggtgccaaaggcaatgtgggtcctccaggagaaccaggccctccg
ggacagcagggaaaccatgggtcccagggactccccggtccccagggactcattggcact
cctggggagaagggtccccctggaaacccaggaattccaggcctcccaggatccgatggc
cctctgggtcacccaggacatgagggccccacgggagagaaaggggctcagggtccacca
gggtcggcaggccctccgggctatcctggacctcggggagtgaagggcacttcaggcaac
cggggcctccagggggagaaaggcgagaagggagaggacggcttcccaggcttcaagggc
gatgtggggctcaaaggtgatcaggggaaacccggagctccaggtccccggggagaggat
ggtcctgaggggccgaaggggcaggcggggcaggctggcgaggaggggcccccaggctca
gctggggagaagggcaagcttggggtgccaggcctcccaggttatccaggacgccctgga
cctaagggatctattggatttcccggtcccctgggacccataggagagaaagggaagtcg
ggaaagacagggcagccaggcctggaaggagagcggggaccaccaggttcccgtggagag
agggggcaaccgggtgccacagggcaaccaggccccaagggcgatgtgggccaggatgga
gcccctgggatccctggagaaaagggcctccctggtctgcaaggccctccaggattccct
gggccaaagggcccccctggtcaccaaggtaaagatgggcgaccagggcaccctggacag
agaggagaactgggcttccaaggtcagacaggcccgcctggaccagctggtgtcttaggc
cctcagggaaagacaggagaagtgggacctctaggtgaaagggggcctccaggcccccct
ggacctcctggtgaacaaggtcttcctggcctggaaggcagagagggggccaagggggaa
ctgggaccaccaggaccccttgggaaagaagggccagctggactcaggggctttcccggc
cccaaagggggccctggggacccgggacctactggcttaaagggtgataagggcccccca
gggcccgtgggggccaatggctcccctggtgagcgcggtcctttgggcccagcaggaggc
attggacttcctggccaaagtggcagcgaaggccccgttggccctgcaggcaagaagggg
tcccggggagaacgtggcccccctggccccactggcaaagatgggatcccagggcccctg
gggcctctgggaccccctggagctgctgggccttctggcgaggaaggggacaagggggat
gtgggtgcccccggacacaaggggagtaaaggcgataaaggagacgcgggcccacctgga
caaccagggatacggggtcctgcaggacacccaggtcccccgggagcagacggggctcag
gggcgccggggacccccaggcctctttgggcagaaaggagatgacggagtcagaggcttt
gtgggggtgattggccctcctggactgcaggggctgccaggccctccgggagagaaaggg
gaggtcggagacgtcgggtccatgggtccccatggagctccaggtcctcggggtccccaa
ggccccactggatcagagggcactccagggctgcctggaggagttggtcagccaggcgcc
gtgggtgagaagggtgagcgaggggacgctggagacccagggcctccaggagccccaggc
atcccggggcccaagggagacattggtgaaaagggggactcaggcccatctggagctgct
ggacccccaggcaagaaaggtccccctggagaggatggagccaaagggagcgtgggcccc
acggggctgcccggagatctagggcccccaggagaccctggagtttcaggcatagatggt
tccccaggggagaagggagaccctggtgatgttgggggaccgggtccgcctggagcttct
ggggagcccggcgcccccgggccccccggcaagaggggtccttcaggccacatgggtcga
gaaggcagagaaggggagaaaggtgccaagggggagccaggtcctgatgggcccccaggg
aggacgggtccaatgggggctagagggccccctggacgtgtggggcctgagggtcttcga
gggatccctggccctgtgggtgaaccaggcctcctgggagcccctggacagatgggccct
cctggccccctggggccctctggcctcccagggctgaagggagacactggccccaagggg
gaaaagggccacattggattgatcggtctcattggccccccgggagaagctggtgagaaa
ggagatcaggggttgccaggcgtgcagggaccccctggtcccaagggagaccctggtccc
cctggtcccattggctctctgggccaccctgggcccccaggtgtggcgggccctctagga
cagaaaggctcaaaagggtctccggggtccatgggcccccgtggagacactggacctgca
ggcccaccaggccccccgggtgcccctgccgagctgcatgggctgcgcaggcgccggcgc
ttcgtcccagtcccgcttccagtcgtggagggcggcctggaggaggtgctggcctcgctc
acatcgctgagcttggagctggagcagctgcggcgtcctcccggcactgcggagcgcccg
ggcctcgtgtgccacgagctgcaccgcaaccacccgcacctgcctgatggggaatactgg
attgaccccaaccagggctgcgcgcgggactcgttcagggttttttgcaacttcacggcg
ggaggagagacctgcctctatcccgacaagaagtttgagatcgtgaaattggcctcctgg
tccaaggaaaagcctggaggctggtatagcacattccgtcgagggaagaagttctcctac
gtggacgccgacgggtccccagtgaatgtcgtgcagctgaacttcctgaaactgctgagt
gccacagctcgccagaacttcacctactcctgccagaatgcagctgcctggctggacgaa
gccacgggtgactacagccactccgcccgcttccttggcaccaatggagaggagctgtct
ttcaaccagacgacagcagccactgtcagcgtcccccaggatggctgccggctccggaaa
ggacagacgaagacccttttcgaattcagctcttctcgagcgggatttctgcccctgtgg
gatgtggcggccactgactttggccagacgaaccaaaagtttgggtttgaactgggcccc
gtctgcttcagcagctga

DBGET integrated database retrieval system