KEGG   Homo sapiens (human): 50515Help
Entry
50515             CDS       T01001                                 

Gene name
CHST11, C4ST, C4ST-1, C4ST1, HSA269537
Definition
(RefSeq) carbohydrate (chondroitin 4) sulfotransferase 11 (EC:2.8.2.5)
  KO
K01017  
chondroitin 4-sulfotransferase 11 [EC:2.8.2.5]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    50515 (CHST11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.5  chondroitin 4-sulfotransferase
     50515 (CHST11)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   50515 (CHST11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q
AA seq 352 aa AA seqDB search
MKPALLEVMRMNRICRMVLATCLGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPL
QELYNPIQLELSNTAVLHQMRRDQVTDTCRANSATSRKRRVLTPNDLKHLVVDEDHELIY
CYVPKVACTNWKRLMMVLTGRGKYSDPMEIPANEAHVSANLKTLNQYSIPEINHRLKSYM
KFLFVREPFERLVSAYRNKFTQKYNISFHKRYGTKIIKRQRKNATQEALRKGDDVKFEEF
VAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLK
FPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLKLE
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagcgctgctggaagtgatgaggatgaacagaatctgccggatggtgctggcc
acttgcttgggatcctttatcctggtcatcttctatttccaaagtatgttgcacccagtc
atgcggaggaatccctttggtgtggacatctgctgccggaaggggtcccgaagccccctg
caggaactctacaacccaatccagctggagctctcaaacactgctgtcctgcaccagatg
cggcgggaccaggtgacagacacgtgccgagccaacagcgccacaagccgtaagcggagg
gtgctgacccccaacgacctgaagcacttggtggtggatgaggaccacgagctcatctac
tgctacgtgcccaaggtggcctgcaccaactggaagcggctcatgatggtcctgaccggg
cgggggaagtacagcgaccccatggagatcccggccaacgaggcacacgtctccgccaac
ctgaagaccctgaaccagtacagcatcccagaaatcaaccaccgcttgaaaagctacatg
aagttcctgtttgtccgggagcccttcgagaggctagtgtccgcctaccgcaacaagttc
acccagaagtacaacatctccttccacaagcggtacggcaccaagatcatcaaacgccag
cggaagaacgccacccaggaggccctgcgcaaaggggacgatgtcaaattcgaggagttt
gtggcctatctcatcgacccacacacccagcgggaggagcctttcaacgaacactggcaa
accgtctactcactctgccatccctgccacatccactatgacctcgtgggcaagtacgag
acactggaagaggattctaattacgtcctgcagctggcaggagtgggcagctacctgaag
ttccccacctatgcaaagtctacgagaactactgatgaaatgaccacagaattcttccag
aacatcagctcagagcaccaaacgcagctgtacgaagtctacaaactcgattttttaatg
ttcaattactcagtgccaagctacctgaaattggaataa

DBGET integrated database retrieval system