KEGG   Homo sapiens (human): 5058Help
Entry
5058              CDS       T01001                                 

Gene name
PAK1, PAKalpha
Definition
(RefSeq) p21 (RAC1) activated kinase 1
  KO
K04409  
p21-activated kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Axon guidance
Hippo signaling pathway - multiple species
Focal adhesion
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Epithelial cell signaling in Helicobacter pylori infection
Proteoglycans in cancer
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5058 (PAK1)
   04010 MAPK signaling pathway
    5058 (PAK1)
   04012 ErbB signaling pathway
    5058 (PAK1)
   04392 Hippo signaling pathway - multiple species
    5058 (PAK1)
   04024 cAMP signaling pathway
    5058 (PAK1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5058 (PAK1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    5058 (PAK1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5058 (PAK1)
   04660 T cell receptor signaling pathway
    5058 (PAK1)
   04666 Fc gamma R-mediated phagocytosis
    5058 (PAK1)
   04062 Chemokine signaling pathway
    5058 (PAK1)
  Development
   04360 Axon guidance
    5058 (PAK1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    5058 (PAK1)
   05211 Renal cell carcinoma
    5058 (PAK1)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5058 (PAK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5058 (PAK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   5058 (PAK1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    5058 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    5058 (PAK1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     5058 (PAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13153(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.5-q14.1
AA seq 545 aa AA seqDB search
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEA
TKNNH
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataacggcctagacattcaagacaaacccccagcccctccgatgagaaatacc
agcactatgattggagccggcagcaaagatgctggaaccctaaaccatggttctaaacct
ctgcctccaaacccagaggagaagaaaaagaaggaccgattttaccgatccattttacct
ggagataaaacaaataaaaagaaagagaaagagcggccagagatttctctcccttcagat
tttgaacacacaattcatgtcggttttgatgctgtcacaggggagtttacgggaatgcca
gagcagtgggcccgcttgcttcagacatcaaatatcactaagtcggagcagaagaaaaac
ccgcaggctgttctggatgtgttggagttttacaactcgaagaagacatccaacagccag
aaatacatgagctttacagataagtcagctgaggattacaattcttctaatgccttgaat
gtgaaggctgtgtctgagactcctgcagtgccaccagtttcagaagatgaggatgatgat
gatgatgatgctaccccaccaccagtgattgctccacgcccagagcacacaaaatctgta
tacacacggtctgtgattgaaccacttcctgtcactccaactcgggacgtggctacatct
cccatttcacctactgaaaataacaccactccaccagatgctttgacccggaatactgag
aagcagaagaagaagcctaaaatgtctgatgaggagatcttggagaaattacgaagcata
gtgagtgtgggcgatcctaagaagaaatatacacggtttgagaagattggacaaggtgct
tcaggcaccgtgtacacagcaatggatgtggccacaggacaggaggtggccattaagcag
atgaatcttcagcagcagcccaagaaagagctgattattaatgagatcctggtcatgagg
gaaaacaagaacccaaacattgtgaattacttggacagttacctcgtgggagatgagctg
tgggttgttatggaatacttggctggaggctccttgacagatgtggtgacagaaacttgc
atggatgaaggccaaattgcagctgtgtgccgtgagtgtctgcaggctctggagttcttg
cattcgaaccaggtcattcacagagacatcaagagtgacaatattctgttgggaatggat
ggctctgtcaagctaactgactttggattctgtgcacagataaccccagagcagagcaaa
cggagcaccatggtaggaaccccatactggatggcaccagaggttgtgacacgaaaggcc
tatgggcccaaggttgacatctggtccctgggcatcatggccatcgaaatgattgaaggg
gagcctccatacctcaatgaaaaccctctgagagccttgtacctcattgccaccaatggg
accccagaacttcagaacccagagaagctgtcagctatcttccgggactttctgaaccgc
tgtctcgagatggatgtggagaagagaggttcagctaaagagctgctacagcatcaattc
ctgaagattgccaagcccctctccagcctcactccactgattgctgcagctaaggaggca
acaaagaacaatcactaa

KEGG   Homo sapiens (human): 5062Help
Entry
5062              CDS       T01001                                 

Gene name
PAK2, PAK65, PAKgamma
Definition
(RefSeq) p21 (RAC1) activated kinase 2
  KO
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5062 (PAK2)
   04010 MAPK signaling pathway
    5062 (PAK2)
   04012 ErbB signaling pathway
    5062 (PAK2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5062 (PAK2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    5062 (PAK2)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    5062 (PAK2)
  Development
   04360 Axon guidance
    5062 (PAK2)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    5062 (PAK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5062 (PAK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   5062 (PAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13177(Tchem)
UniProt: 
Position
3q29
AA seq 524 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAP
PVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagataagcctccagcacctcctgtgcgaatgagcagc
accatctttagcactggaggcaaagaccctttgtcagccaatcacagtttgaaacctttg
ccctctgttccagaagagaaaaagcccaggcataaaatcatctccatattctcaggcaca
gagaaaggaagtaaaaagaaagaaaaggaacggccagaaatttctcctccatctgatttt
gagcacaccatccatgttggctttgatgctgttactggagaattcactggcatgccagaa
cagtgggctcgattactacagacctccaatatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcctaaagttctacgactccaacacagtgaagcagaaatatctg
agctttactcctcctgagaaagatggctttccttctggaacaccagcactgaatgccaag
ggaacagaagcacccgcagtagtgacagaggaggaggatgatgatgaagagactgctcct
cccgttattgccccgcgaccggatcatacgaaatcaatttacacacggtctgtaattgac
cctgttcctgcaccagttggtgattcacatgttgatggtgctgccaagtctttagacaaa
cagaaaaagaagactaagatgacagatgaagagattatggagaaattaagaactatcgtg
agcataggtgaccctaagaaaaaatatacaagatatgaaaaaattggacaaggggcttct
ggtacagttttcactgctactgacgttgcactgggacaggaggttgctatcaaacaaatt
aatttacagaaacagccaaagaaggaactgatcattaacgagattctggtgatgaaagaa
ttgaaaaatcccaacatcgttaactttttggacagttacctggtaggagatgaattgttt
gtggtcatggaataccttgctggggggtcactcactgatgtggtaacagaaacgtgcatg
gatgaagcacagattgctgctgtatgcagagagtgtttacaggcattggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaatgtacttttgggaatggaagga
tctgttaagctcactgactttggtttctgtgcccagatcacccctgagcagagcaaacgc
agtaccatggtcggaacgccatactggatggcaccagaggtggttacacggaaagcttat
ggccctaaagtcgacatatggtctctgggtatcatggctattgagatggtagaaggagag
cctccatacctcaatgaaaatcccttgagggccttgtacctaatagcaactaatggaacc
ccagaacttcagaatccagagaaactttccccaatatttcgggatttcttaaatcgatgt
ttggaaatggatgtggaaaaaaggggttcagccaaagaattattacagcatcctttcctg
aaactggccaaaccgttatctagcttgacaccactgatcatggcagctaaagaagcaatg
aagagtaaccgttaa

DBGET integrated database retrieval system