KEGG   Homo sapiens (human): 506Help
Entry
506               CDS       T01001                                 

Gene name
ATP5B, ATPMB, ATPSB, HEL-S-271
Definition
ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide (EC:3.6.3.14)
Orthology
K02133  
F-type H+-transporting ATPase subunit beta [EC:3.6.3.14]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    506 (ATP5B)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    506 (ATP5B)
   05012 Parkinson's disease
    506 (ATP5B)
   05016 Huntington's disease
    506 (ATP5B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     506 (ATP5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.13
AA seq 529 aa AA seqDB search
MLGFVGRVAAAPASGALRRLTPSASLPPAQLLLRAAPTAVHPVRDYAAQTSPSPKAGAAT
GRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLV
RGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ
EILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERT
REGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQD
VLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAI
YVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDV
ARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGK
LVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggggtttgtgggtcgggtggccgctgctccggcctccggggccttgcggagactc
accccttcagcgtcgctgcccccagctcagctcttactgcgggccgctccgacggcggtc
catcctgtcagggactatgcggcgcaaacatctccttcgccaaaagcaggcgccgccacc
gggcgcatcgtggcggtcattggcgcagtggtggacgtccagtttgatgagggactacca
ccaattctaaatgccctggaagtgcaaggcagggagaccagactggttttggaggtggcc
cagcatttgggtgagagcacagtaaggactattgctatggatggtacagaaggcttggtt
agaggccagaaagtactggattctggtgcaccaatcaaaattcctgttggtcctgagact
ttgggcagaatcatgaatgtcattggagaacctattgatgaaagaggtcccatcaaaacc
aaacaatttgctcccattcatgctgaggctccagagttcatggaaatgagtgttgagcag
gaaattctggtgactggtatcaaggttgtcgatctgctagctccctatgccaagggtggc
aaaattgggctttttggtggtgctggagttggcaagactgtactgatcatggagttaatc
aacaatgtcgccaaagcccatggtggttactctgtgtttgctggtgttggtgagaggacc
cgtgaaggcaatgatttataccatgaaatgattgaatctggtgttatcaacttaaaagat
gccacctctaaggtagcgctggtatatggtcaaatgaatgaaccacctggtgctcgtgcc
cgggtagctctgactgggctgactgtggctgaatacttcagagaccaagaaggtcaagat
gtactgctatttattgataacatctttcgcttcacccaggctggttcagaggtgtctgca
ttattgggccgaatcccttctgctgtgggctatcagcctaccctggccactgacatgggt
actatgcaggaaagaattaccactaccaagaagggatctatcacctctgtacaggctatc
tatgtgcctgctgatgacttgactgaccctgcccctgctactacgtttgcccatttggat
gctaccactgtactgtcgcgtgccattgctgagctgggcatctatccagctgtggatcct
ctagactccacctctcgtatcatggatcccaacattgttggcagtgagcattacgatgtt
gcccgtggggtgcaaaagatcctgcaggactacaaatccctccaggatatcattgccatc
ctgggtatggatgaactttctgaggaagacaagttgaccgtgtcccgtgcacggaaaata
cagcgtttcttgtctcagccattccaggttgctgaggtcttcacaggtcatatggggaag
ctggtacccctgaaggagaccatcaaaggattccagcagattttggcaggtgaatatgac
catctcccagaacaggccttctatatggtgggacccattgaagaagctgtggcaaaagct
gataagctggctgaagagcattcatcgtga

DBGET integrated database retrieval system