KEGG   Homo sapiens (human): 50613Help
Entry
50613             CDS       T01001                                 

Gene name
UBQLN3, TUP-1
Definition
(RefSeq) ubiquilin 3
  KO
K04523  ubiquilin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    50613 (UBQLN3)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    50613 (UBQLN3)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    50613 (UBQLN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin UBA Rad60-SLD Rad60-SLD_2 DUF2407 YukD HOIP-UBA
Motif
Other DBs
NCBI-GeneID: 50613
NCBI-ProteinID: NP_001334025
OMIM: 605473
HGNC: 12510
Ensembl: ENSG00000175520
Vega: OTTHUMG00000066886
Pharos: Q9H347(Tbio)
UniProt: Q9H347 A0A140VJZ3
Structure
PDB: 

Jmol
Position
11p15.4
AA seq 655 aa AA seqDB search
MAKGGEALPQGSPAPVQDPHLIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQ
LVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKRQHRAMGNECPAASVPTQGPSPGSLPQP
SSIYPADGPPAFSLGLLTGLSRLGLAYRGFPDQPSSLMRQHVSVPEFVTQLIDDPFIPGL
LSNTGLVRQLVLDNPHMQQLIQHNPEIGHILNNPEIMRQTLEFLRNPAMMQEMIRSQDRV
LSNLESIPGGYNVLCTMYTDIMDPMLNAVQEQFGGNPFATATTDNATTTTSQPSRMENCD
PLPNPWTSTHGGSGSRQGRQDGDQDAPDIRNRFPNFLGIIRLYDYLQQLHENPQSLGTYL
QGTASALSQSQEPPPSVNRVPPSSPSSQEPGSGQPLPEESVAIKGRSSCPAFLRYPTENS
TGQGGDQDGAGKSSTGHSTNLPDLVSGLGDSANRVPFAPLSFSPTAAIPGIPEPPWLPSP
AYPRSLRPDGMNPAPQLQDEIQPQLPLLMHLQAAMANPRALQALRQIEQGLQVLATEAPR
LLLWFMPCLAGTGSVAGGIESREDPLMSEDPLPNPPPEVFPALDSAELGFLSPPFLHMLQ
DLVSTNPQQLQPEAHFQVQLEQLRSMGFLNREANLQALIATGGDVDAAVEKLRQS
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaggtggagaagccctgccacagggcagcccagcaccagtccaggatccccac
ctcatcaaggtgacagtgaagacgcccaaagacaaggaggatttctcagttacagacaca
tgcactatccagcagctgaaggaagagatatctcagcgctttaaggcccaccccgatcag
cttgttctaatctttgctggcaaaatcctcaaggatcctgactcactggcacagtgtgga
gtgcgagatggcctcactgtccacctggtcatcaagaggcagcaccgtgccatgggcaat
gagtgcccagctgcctctgtccctacccagggcccaagtcctggatcactccctcagcca
agctccatttacccagcagatgggccccctgcctttagcttaggtctcctcacaggcctc
agtaggctgggcttggcctatcgtggcttccctgaccagccaagctccctgatgcggcag
catgtgtctgtgcctgagtttgtgactcagctcattgatgaccccttcatcccgggtctg
ctgtccaacacaggcctagtacgccagctggttcttgacaacccccatatgcagcagctg
atccagcacaaccctgagattgggcatattcttaacaacccggaaattatgcggcagaca
ctggagtttttacgtaaccctgccatgatgcaggagatgatacgtagccaggaccgggtg
ctcagtaacttggagagcattcctggtggctacaatgtgctttgcactatgtacacagat
attatggacccaatgcttaacgcagtccaggagcagtttggcggcaatccctttgccact
gccactactgataatgccaccaccaccaccagccaaccttcaaggatggagaattgtgac
cctctccccaacccctggacttccacacatggaggctcaggtagcaggcaaggaaggcag
gatggggatcaggatgcacctgacattagaaataggtttccaaactttctgggtattata
aggctctatgactatctccagcaattacacgagaacccccagtccctaggaacttatcta
caggggactgcatctgccctcagccaaagccaggaaccaccaccatcagtaaacagagtt
cccccatcgtcaccctcatctcaggagcctgggtcaggccagcctctccccgaggagtca
gtagcaatcaagggaaggtcctcctgcccagctttcctgagataccccacagagaacagt
actggacaaggtggagaccaagatggtgcagggaaaagctctactggacatagcacaaac
ttgcctgatcttgtctcggggctgggagattctgccaacagggttccatttgctccctta
tctttttcccccacggcagccattcctggaatccctgagcctccctggctgccatccccg
gcttatccaagatctctgaggccagatggcatgaatccagctccacagttacaggatgag
atacaaccacagctgccactgctgatgcaccttcaggcagccatggcaaacccccgtgcc
ctgcaagccctgcggcagattgagcagggtctacaggtcctagctactgaagcacctcgc
ctcctactctggttcatgccttgcctagcagggacgggtagtgtggcaggaggtatagag
tctagagaagatccccttatgtctgaggatcctctcccaaatccacctcctgaggtgttc
ccagcactggactctgcagagctgggcttcctttcccctccctttctccatatgctgcaa
gatttagttagtacaaatccccagcagctgcagcctgaggctcactttcaggtgcagctg
gagcaactgcggtccatgggctttctgaatcgtgaagccaatcttcaggccctcattgct
acggggggcgacgtggatgctgctgtggagaagctgagacagtcgtag

DBGET integrated database retrieval system