KEGG   Homo sapiens (human): 50613Help
Entry
50613             CDS       T01001                                 

Gene name
UBQLN3, TUP-1
Definition
ubiquilin 3
Orthology
K04523  
ubiquilin
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    50613 (UBQLN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15
AA seq 655 aa AA seqDB search
MAKGGEALPQGSPAPVQDPHLIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQ
LVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKRQHRAMGNECPAASVPTQGPSPGSLPQP
SSIYPADGPPAFSLGLLTGLSRLGLAYRGFPDQPSSLMRQHVSVPEFVTQLIDDPFIPGL
LSNTGLVRQLVLDNPHMQQLIQHNPEIGHILNNPEIMRQTLEFLRNPAMMQEMIRSQDRV
LSNLESIPGGYNVLCTMYTDIMDPMLNAVQEQFGGNPFATATTDNATTTTSQPSRMENCD
PLPNPWTSTHGGSGSRQGRQDGDQDAPDIRNRFPNFLGIIRLYDYLQQLHENPQSLGTYL
QGTASALSQSQEPPPSVNRVPPSSPSSQEPGSGQPLPEESVAIKGRSSCPAFLRYPTENS
TGQGGDQDGAGKSSTGHSTNLPDLVSGLGDSANRVPFAPLSFSPTAAIPGIPEPPWLPSP
AYPRSLRPDGMNPAPQLQDEIQPQLPLLMHLQAAMANPRALQALRQIEQGLQVLATEAPR
LLLWFMPCLAGTGSVAGGIESREDPLMSEDPLPNPPPEVFPALDSAELGFLSPPFLHMLQ
DLVSTNPQQLQPEAHFQVQLEQLRSMGFLNREANLQALIATGGDVDAAVEKLRQS
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaggtggagaagccctgccacagggcagcccagcaccagtccaggatccccac
ctcatcaaggtgacagtgaagacgcccaaagacaaggaggatttctcagttacagacaca
tgcactatccagcagctgaaggaagagatatctcagcgctttaaggcccaccccgatcag
cttgttctaatctttgctggcaaaatcctcaaggatcctgactcactggcacagtgtgga
gtgcgagatggcctcactgtccacctggtcatcaagaggcagcaccgtgccatgggcaat
gagtgcccagctgcctctgtccctacccagggcccaagtcctggatcactccctcagcca
agctccatttacccagcagatgggccccctgcctttagcttaggtctcctcacaggcctc
agtaggctgggcttggcctatcgtggcttccctgaccagccaagctccctgatgcggcag
catgtgtctgtgcctgagtttgtgactcagctcattgatgaccccttcatcccgggtctg
ctgtccaacacaggcctagtacgccagctggttcttgacaacccccatatgcagcagctg
atccagcacaaccctgagattgggcatattcttaacaacccggaaattatgcggcagaca
ctggagtttttacgtaaccctgccatgatgcaggagatgatacgtagccaggaccgggtg
ctcagtaacttggagagcattcctggtggctacaatgtgctttgcactatgtacacagat
attatggacccaatgcttaacgcagtccaggagcagtttggcggcaatccctttgccact
gccactactgataatgccaccaccaccaccagccaaccttcaaggatggagaattgtgac
cctctccccaacccctggacttccacacatggaggctcaggtagcaggcaaggaaggcag
gatggggatcaggatgcacctgacattagaaataggtttccaaactttctgggtattata
aggctctatgactatctccagcaattacacgagaacccccagtccctaggaacttatcta
caggggactgcatctgccctcagccaaagccaggaaccaccaccatcagtaaacagagtt
cccccatcgtcaccctcatctcaggagcctgggtcaggccagcctctccccgaggagtca
gtagcaatcaagggaaggtcctcctgcccagctttcctgagataccccacagagaacagt
actggacaaggtggagaccaagatggtgcagggaaaagctctactggacatagcacaaac
ttgcctgatcttgtctcggggctgggagattctgccaacagggttccatttgctccctta
tctttttcccccacggcagccattcctggaatccctgagcctccctggctgccatccccg
gcttatccaagatctctgaggccagatggcatgaatccagctccacagttacaggatgag
atacaaccacagctgccactgctgatgcaccttcaggcagccatggcaaacccccgtgcc
ctgcaagccctgcggcagattgagcagggtctacaggtcctagctactgaagcacctcgc
ctcctactctggttcatgccttgcctagcagggacgggtagtgtggcaggaggtatagag
tctagagaagatccccttatgtctgaggatcctctcccaaatccacctcctgaggtgttc
ccagcactggactctgcagagctgggcttcctttcccctccctttctccatatgctgcaa
gatttagttagtacaaatccccagcagctgcagcctgaggctcactttcaggtgcagctg
gagcaactgcggtccatgggctttctgaatcgtgaagccaatcttcaggccctcattgct
acggggggcgacgtggatgctgctgtggagaagctgagacagtcgtag

DBGET integrated database retrieval system