KEGG   Homo sapiens (human): 50615Help
Entry
50615             CDS       T01001                                 

Gene name
IL21R, CD360, NILR
Definition
interleukin 21 receptor
Orthology
K05075  
interleukin 21 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Inflammatory bowel disease (IBD)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    50615 (IL21R)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    50615 (IL21R)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    50615 (IL21R)
Cellular antigens [BR:hsa04090]
 Proteins
  50615 (IL21R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p11
AA seq 538 aa AA seqDB search
MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKD
EATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKP
APPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDS
RSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLL
LLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSS
LELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGG
SAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLD
AGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGS
PLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtggctgggccgcccccttgctcctgctgctgctccagggaggctggggctgc
cccgacctcgtctgctacaccgattacctccagacggtcatctgcatcctggaaatgtgg
aacctccaccccagcacgctcacccttacctggcaagaccagtatgaagagctgaaggac
gaggccacctcctgcagcctccacaggtcggcccacaatgccacgcatgccacctacacc
tgccacatggatgtattccacttcatggccgacgacattttcagtgtcaacatcacagac
cagtctggcaactactcccaggagtgtggcagctttctcctggctgagagcatcaagccg
gctccccctttcaacgtgactgtgaccttctcaggacagtataatatctcctggcgctca
gattacgaagaccctgccttctacatgctgaagggcaagcttcagtatgagctgcagtac
aggaaccggggagacccctgggctgtgagtccgaggagaaagctgatctcagtggactca
agaagtgtctccctcctccccctggagttccgcaaagactcgagctatgagctgcaggtg
cgggcagggcccatgcctggctcctcctaccaggggacctggagtgaatggagtgacccg
gtcatctttcagacccagtcagaggagttaaaggaaggctggaaccctcacctgctgctt
ctcctcctgcttgtcatagtcttcattcctgccttctggagcctgaagacccatccattg
tggaggctatggaagaagatatgggccgtccccagccctgagcggttcttcatgcccctg
tacaagggctgcagcggagacttcaagaaatgggtgggtgcacccttcactggctccagc
ctggagctgggaccctggagcccagaggtgccctccaccctggaggtgtacagctgccac
ccaccacggagcccggccaagaggctgcagctcacggagctacaagaaccagcagagctg
gtggagtctgacggtgtgcccaagcccagcttctggccgacagcccagaactcggggggc
tcagcttacagtgaggagagggatcggccatacggcctggtgtccattgacacagtgact
gtgctagatgcagaggggccatgcacctggccctgcagctgtgaggatgacggctaccca
gccctggacctggatgctggcctggagcccagcccaggcctagaggacccactcttggat
gcagggaccacagtcctgtcctgtggctgtgtctcagctggcagccctgggctaggaggg
cccctgggaagcctcctggacagactaaagccaccccttgcagatggggaggactgggct
gggggactgccctggggtggccggtcacctggaggggtctcagagagtgaggcgggctca
cccctggccggcctggatatggacacgtttgacagtggctttgtgggctctgactgcagc
agccctgtggagtgtgacttcaccagccccggggacgaaggacccccccggagctacctc
cgccagtgggtggtcattcctccgccactttcgagccctggaccccaggccagctaa

DBGET integrated database retrieval system