KEGG   Homo sapiens (human): 50615Help
Entry
50615             CDS       T01001                                 

Gene name
IL21R, CD360, NILR
Definition
interleukin 21 receptor
Orthology
K05075  
interleukin 21 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Inflammatory bowel disease (IBD)
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p11
AA seq 538 aa AA seqDB search
MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKD
EATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKP
APPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDS
RSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLL
LLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSS
LELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGG
SAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLD
AGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGS
PLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtggctgggccgcccccttgctcctgctgctgctccagggaggctggggctgc
cccgacctcgtctgctacaccgattacctccagacggtcatctgcatcctggaaatgtgg
aacctccaccccagcacgctcacccttacctggcaagaccagtatgaagagctgaaggac
gaggccacctcctgcagcctccacaggtcggcccacaatgccacgcatgccacctacacc
tgccacatggatgtattccacttcatggccgacgacattttcagtgtcaacatcacagac
cagtctggcaactactcccaggagtgtggcagctttctcctggctgagagcatcaagccg
gctccccctttcaacgtgactgtgaccttctcaggacagtataatatctcctggcgctca
gattacgaagaccctgccttctacatgctgaagggcaagcttcagtatgagctgcagtac
aggaaccggggagacccctgggctgtgagtccgaggagaaagctgatctcagtggactca
agaagtgtctccctcctccccctggagttccgcaaagactcgagctatgagctgcaggtg
cgggcagggcccatgcctggctcctcctaccaggggacctggagtgaatggagtgacccg
gtcatctttcagacccagtcagaggagttaaaggaaggctggaaccctcacctgctgctt
ctcctcctgcttgtcatagtcttcattcctgccttctggagcctgaagacccatccattg
tggaggctatggaagaagatatgggccgtccccagccctgagcggttcttcatgcccctg
tacaagggctgcagcggagacttcaagaaatgggtgggtgcacccttcactggctccagc
ctggagctgggaccctggagcccagaggtgccctccaccctggaggtgtacagctgccac
ccaccacggagcccggccaagaggctgcagctcacggagctacaagaaccagcagagctg
gtggagtctgacggtgtgcccaagcccagcttctggccgacagcccagaactcggggggc
tcagcttacagtgaggagagggatcggccatacggcctggtgtccattgacacagtgact
gtgctagatgcagaggggccatgcacctggccctgcagctgtgaggatgacggctaccca
gccctggacctggatgctggcctggagcccagcccaggcctagaggacccactcttggat
gcagggaccacagtcctgtcctgtggctgtgtctcagctggcagccctgggctaggaggg
cccctgggaagcctcctggacagactaaagccaccccttgcagatggggaggactgggct
gggggactgccctggggtggccggtcacctggaggggtctcagagagtgaggcgggctca
cccctggccggcctggatatggacacgtttgacagtggctttgtgggctctgactgcagc
agccctgtggagtgtgacttcaccagccccggggacgaaggacccccccggagctacctc
cgccagtgggtggtcattcctccgccactttcgagccctggaccccaggccagctaa

DBGET integrated database retrieval system