KEGG   Homo sapiens (human): 50616Help
Entry
50616             CDS       T01001                                 

Gene name
IL22, IL-21, IL-22, IL-D110, IL-TIF, ILTIF, TIFIL-23, TIFa, zcyto18
Definition
interleukin 22
Orthology
K05445  
interleukin 22
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Inflammatory bowel disease (IBD)
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q15
AA seq 179 aa AA seqDB search
MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLA
KEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVP
FLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggccgccctgcagaaatctgtgagctctttccttatggggaccctggccaccagctgc
ctccttctcttggccctcttggtacagggaggagcagctgcgcccatcagctcccactgc
aggcttgacaagtccaacttccagcagccctatatcaccaaccgcaccttcatgctggct
aaggaggctagcttggctgataacaacacagacgttcgtctcattggggagaaactgttc
cacggagtcagtatgagtgagcgctgctatctgatgaagcaggtgctgaacttcaccctt
gaagaagtgctgttccctcaatctgataggttccagccttatatgcaggaggtggtgccc
ttcctggccaggctcagcaacaggctaagcacatgtcatattgaaggtgatgacctgcat
atccagaggaatgtgcaaaagctgaaggacacagtgaaaaagcttggagagagtggagag
atcaaagcaattggagaactggatttgctgtttatgtctctgagaaatgcctgcatttga

DBGET integrated database retrieval system