KEGG   Homo sapiens (human): 50617Help
Entry
50617             CDS       T01001                                 

Gene name
ATP6V0A4, A4, ATP6N1B, ATP6N2, RDRTA2, RTA1C, RTADR, STV1, VPH1, VPP2
Definition
ATPase, H+ transporting, lysosomal V0 subunit a4 (EC:3.6.3.14)
Orthology
K02154  
V-type H+-transporting ATPase subunit a
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Lysosome
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Tuberculosis
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Disease
H00428  
Distal renal tubular acidosis (RTA type 1)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    50617 (ATP6V0A4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    50617 (ATP6V0A4)
   04142 Lysosome
    50617 (ATP6V0A4)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    50617 (ATP6V0A4)
  Nervous system
   04721 Synaptic vesicle cycle
    50617 (ATP6V0A4)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    50617 (ATP6V0A4)
  Infectious diseases
   05110 Vibrio cholerae infection
    50617 (ATP6V0A4)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    50617 (ATP6V0A4)
   05152 Tuberculosis
    50617 (ATP6V0A4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   50617 (ATP6V0A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q34
AA seq 840 aa AA seqDB search
MVSVFRSEEMCLSQLFLQVEAAYCCVAELGELGLVQFKDLNMNVNSFQRKFVNEVRRCES
LERILRFLEDEMQNEIVVQLLEKSPLTPLPREMITLETVLEKLEGELQEANQNQQALKQS
FLELTELKYLLKKTQDFFETETNLADDFFTEDTSGLLELKAVPAYMTGKLGFIAGVINRE
RMASFERLLWRICRGNVYLKFSEMDAPLEDPVTKEEIQKNIFIIFYQGEQLRQKIKKICD
GFRATVYPCPEPAVERREMLESVNVRLEDLITVITQTESHRQRLLQEAAANWHSWLIKVQ
KMKAVYHILNMCNIDVTQQCVIAEIWFPVADATRIKRALEQGMELSGSSMAPIMTTVQSK
TAPPTFNRTNKFTAGFQNIVDAYGVGSYREINPAPYTIITFPFLFAVMFGDCGHGTVMLL
AALWMILNERRLLSQKTDNEIWNTFFHGRYLILLMGIFSIYTGLIYNDCFSKSLNIFGSS
WSVQPMFRNGTWNTHVMEESLYLQLDPAIPGVYFGNPYPFGIDPIWNLASNKLTFLNSYK
MKMSVILGIVQMVFGVILSLFNHIYFRRTLNIILQFIPEMIFILCLFGYLVFMIIFKWCC
FDVHVSQHAPSILIHFINMFLFNYSDSSNAPLYKHQQEVQSFFVVMALISVPWMLLIKPF
ILRASHRKSQLQASRIQEDATENIEGDSSSPSSRSGQRTSADTHGALDDHGEEFNFGDVF
VHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVMNSGLQTRGWGGIVGVFI
IFAVFAVLTVAILLIMEGLSAFLHALRLHWVEFQNKFYVGDGYKFSPFSFKHILDGTAEE
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctgtgtttcgaagcgaggagatgtgtttgtcacaactgtttctccaggtggaa
gctgcatattgctgtgtggctgagctcggagagctcggattggttcagttcaaagattta
aatatgaatgtgaacagctttcaaaggaaatttgtgaatgaagtcagaaggtgtgaatca
ctggagagaatcctccgttttctggaagacgagatgcaaaatgagattgtagttcagttg
ctcgagaaaagcccactgaccccgctcccacgggaaatgattaccctggagactgttcta
gaaaaactggaaggagagttacaggaagccaaccagaaccagcaggccttgaaacaaagc
ttcctagaactgacagaactgaaatacctcctgaagaaaacccaagacttctttgagacg
gaaaccaatttagctgatgatttctttactgaggacacttctggcctcctggagttgaaa
gcagtgcctgcatatatgaccggaaagttggggttcatagccggtgtgatcaacagggag
aggatggcttcctttgagcggttactgtggcgaatctgccgaggaaacgtgtacttgaag
ttcagtgagatggacgcccctctggaggatcctgtgacgaaagaagaaattcagaagaac
atattcatcatattttaccaaggagagcagctcaggcagaaaatcaagaagatctgtgat
gggtttcgagccactgtctacccttgcccagagcctgcggtggagcgcagagagatgttg
gagagcgtcaatgtgaggctggaagatttaatcaccgtcataacacaaacagagtctcac
cgccagcgcctgctgcaggaagccgctgccaactggcactcctggctcatcaaggtgcag
aagatgaaagctgtctaccacatcctgaacatgtgcaacatcgacgtcacccagcagtgt
gtcatcgccgagatctggttcccggtggcagatgccacacgtatcaagagggcactggag
caaggcatggaactaagtggctcctccatggcccccatcatgaccacagtgcaatctaaa
acagcccctcccacatttaacaggaccaataaattcacagctggcttccagaatattgtt
gatgcctatggtgtcggcagctaccgggagataaacccagccccctacaccatcatcact
ttccccttcctgttcgctgtgatgtttggagactgtggtcatggaaccgtgatgctcctg
gctgcactttggatgattctgaatgagagacgcttgctctcccagaagacagacaatgag
atttggaacaccttcttccacgggcgctatctgatcctacttatgggcatcttctccatc
tacacgggtttgatctacaatgactgcttctccaagtccttgaacatctttggctcttct
tggagtgtccaacccatgttcagaaacggcacatggaatactcatgtaatggaggaaagt
ctatatctgcagctggacccagccataccaggagtgtattttggaaatccatacccgttt
gggattgatccgatttggaacttggcttcaaacaaactcacatttctgaactcgtataaa
atgaagatgtcggtgatcctgggaattgtccagatggttttcggtgtcatcctcagcctt
ttcaatcacatatacttcagaagaactctcaacatcattctgcaatttatccctgagatg
atttttatcctgtgtctgtttggatacctggttttcatgatcattttcaaatggtgctgc
tttgacgtccatgtatctcagcacgcccccagcatcctcatccacttcatcaacatgttt
ctgtttaactacagtgactcttccaacgcacccctctacaaacatcagcaagaagtccaa
agtttctttgtggttatggctttgatttctgtgccgtggatgcttctgattaagccgttt
attcttagagccagtcatcggaaatcccagctgcaggcatccaggatccaagaagatgcc
actgagaacattgaaggtgatagctccagcccttctagccgttctggccagaggacttct
gcagatacccacggggctctggacgaccatggagaagagttcaactttggagacgtcttt
gtccaccaagccatccacaccatcgagtactgcctgggctgcatttcaaacacagcctcc
tacctgcggctctgggccctcagcctggctcatgcacaactgtctgaagtgctctggact
atggtgatgaacagcggccttcagacgcgaggctggggaggaatcgtcggggtttttatt
atttttgccgtatttgctgtcctgacagtagccatccttctgatcatggagggcctctct
gctttcctgcacgccctgcgactgcactgggttgagttccagaacaagttctatgtcggg
gatggttacaagttttctccattctcctttaaacacatcctggatggcacagccgaggag
tag

DBGET integrated database retrieval system