KEGG   Homo sapiens (human): 5063Help
Entry
5063              CDS       T01001                                 

Gene name
PAK3, ARA, MRX30, MRX47, OPHN3, PAK-3, PAK3beta, bPAK, beta-PAK
Definition
(RefSeq) p21 (RAC1) activated kinase 3
  KO
K05733  
p21-activated kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Disease
H00480  
Non-syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5063 (PAK3)
   04012 ErbB signaling pathway
    5063 (PAK3)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5063 (PAK3)
  Cell motility
   04810 Regulation of actin cytoskeleton
    5063 (PAK3)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    5063 (PAK3)
  Development
   04360 Axon guidance
    5063 (PAK3)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    5063 (PAK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5063 (PAK3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   5063 (PAK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O75914(Tchem)
UniProt: 
Position
Xq23
AA seq 559 aa AA seqDB search
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTS
NITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPP
LAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSA
ENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTA
LDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYL
AGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTD
FGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNE
NPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPL
SSLTPLIIAAKEAIKNSSR
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacggtctggataatgaagagaaacccccggctcctccactgaggatgaatagt
aacaaccgggattcttcagcactcaaccacagctccaaaccacttcccatggcccctgaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaggagaaagagcgcccagagatctctcttccttcagactttgagcatacgatt
catgtggggtttgatgcagtcaccggggaattcactccagatctctatggctcacagatg
tgcccagggaagctcccagagggaattccagagcaatgggcacgattactccaaacttcc
aacataacaaaattggaacagaagaagaacccacaagctgttctagatgttctcaaattc
tatgattccaaagaaacagtcaacaaccagaaatacatgagctttacatcaggagataaa
agtgcacatggatacatagcagcccatccttcgagtacaaaaacagcatctgagcctcca
ttggcccctcctgtgtctgaagaagaagatgaagaggaagaagaagaagaagatgaaaat
gagccaccaccagttatcgcaccaagaccagagcatacaaaatcaatctatactcgttct
gtggttgaatccattgcttcaccagcagtaccaaataaagaggtcacaccaccctctgct
gaaaatgccaattccagtactttgtacaggaacacagatcggcaaagaaaaaaatccaag
atgacagatgaggagatcttagagaagctaagaagcattgtgagtgttggggacccaaag
aaaaaatacacaagatttgaaaaaattggtcaaggggcatcaggtactgtttatacagca
ctagacattgcaacaggacaagaggtggccataaagcagatgaaccttcaacagcaaccc
aagaaggaattaattattaatgaaattctggtcatgagggaaaataagaaccctaatatt
gttaattatttagatagctacttggtgggtgatgaactatgggtagtcatggaatacttg
gctggtggctctctgactgatgtggtcacagagacctgtatggatgaaggacagatagca
gctgtctgcagagagtgcctgcaagctttggatttcctgcactcaaaccaggtgatccat
agagatataaagagtgacaatattcttctcgggatggatggctctgttaaattgactgac
tttgggttctgtgcccagatcactcctgagcaaagtaaacgaagcactatggtgggaacc
ccatattggatggcacctgaggtggtgactcgaaaagcttatggtccgaaagttgatatc
tggtctcttggaattatggcaattgaaatggtggaaggtgaacccccttaccttaatgaa
aatccactcagggcattgtatctgatagccactaatggaactccagagctccagaatcct
gagagactgtcagctgtattccgtgactttttaaatcgctgtcttgagatggatgtggat
aggcgaggatctgccaaggagcttttgcagcatccatttttaaaattagccaagcctctc
tccagcctgactcctctgattatcgctgcaaaggaagcaattaagaacagcagccgctaa

DBGET integrated database retrieval system