KEGG   Homo sapiens (human): 5063Help
Entry
5063              CDS       T01001                                 

Gene name
PAK3, MRX30, MRX47, OPHN3, PAK-3, PAK3beta, bPAK, beta-PAK
Definition
(RefSeq) p21 protein (Cdc42/Rac)-activated kinase 3 (EC:2.7.11.1)
  KO
K05733  
p21-activated kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Disease
H00480  
Non-syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5063 (PAK3)
   04012 ErbB signaling pathway
    5063 (PAK3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    5063 (PAK3)
  Cellular commiunity
   04510 Focal adhesion
    5063 (PAK3)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    5063 (PAK3)
  Development
   04360 Axon guidance
    5063 (PAK3)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    5063 (PAK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5063 (PAK3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   5063 (PAK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq23
AA seq 559 aa AA seqDB search
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTS
NITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPP
LAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSA
ENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTA
LDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYL
AGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTD
FGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNE
NPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPL
SSLTPLIIAAKEAIKNSSR
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacggtctggataatgaagagaaacccccggctcctccactgaggatgaatagt
aacaaccgggattcttcagcactcaaccacagctccaaaccacttcccatggcccctgaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaggagaaagagcgcccagagatctctcttccttcagactttgagcatacgatt
catgtggggtttgatgcagtcaccggggaattcactccagatctctatggctcacagatg
tgcccagggaagctcccagagggaattccagagcaatgggcacgattactccaaacttcc
aacataacaaaattggaacagaagaagaacccacaagctgttctagatgttctcaaattc
tatgattccaaagaaacagtcaacaaccagaaatacatgagctttacatcaggagataaa
agtgcacatggatacatagcagcccatccttcgagtacaaaaacagcatctgagcctcca
ttggcccctcctgtgtctgaagaagaagatgaagaggaagaagaagaagaagatgaaaat
gagccaccaccagttatcgcaccaagaccagagcatacaaaatcaatctatactcgttct
gtggttgaatccattgcttcaccagcagtaccaaataaagaggtcacaccaccctctgct
gaaaatgccaattccagtactttgtacaggaacacagatcggcaaagaaaaaaatccaag
atgacagatgaggagatcttagagaagctaagaagcattgtgagtgttggggacccaaag
aaaaaatacacaagatttgaaaaaattggtcaaggggcatcaggtactgtttatacagca
ctagacattgcaacaggacaagaggtggccataaagcagatgaaccttcaacagcaaccc
aagaaggaattaattattaatgaaattctggtcatgagggaaaataagaaccctaatatt
gttaattatttagatagctacttggtgggtgatgaactatgggtagtcatggaatacttg
gctggtggctctctgactgatgtggtcacagagacctgtatggatgaaggacagatagca
gctgtctgcagagagtgcctgcaagctttggatttcctgcactcaaaccaggtgatccat
agagatataaagagtgacaatattcttctcgggatggatggctctgttaaattgactgac
tttgggttctgtgcccagatcactcctgagcaaagtaaacgaagcactatggtgggaacc
ccatattggatggcacctgaggtggtgactcgaaaagcttatggtccgaaagttgatatc
tggtctcttggaattatggcaattgaaatggtggaaggtgaacccccttaccttaatgaa
aatccactcagggcattgtatctgatagccactaatggaactccagagctccagaatcct
gagagactgtcagctgtattccgtgactttttaaatcgctgtcttgagatggatgtggat
aggcgaggatctgccaaggagcttttgcagcatccatttttaaaattagccaagcctctc
tccagcctgactcctctgattatcgctgcaaaggaagcaattaagaacagcagccgctaa

DBGET integrated database retrieval system