KEGG   Homo sapiens (human): 50632Help
Entry
50632             CDS       T01001                                 

Gene name
CALY, DRD1IP, NSG3
Definition
(RefSeq) calcyon neuron specific vesicular protein
  KO
K15493  neuron-specific vesicular protein calcyon
Organism
hsa  Homo sapiens (human)
Pathway
hsa04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    50632 (CALY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calcyon
Motif
Other DBs
NCBI-GeneID: 50632
NCBI-ProteinID: NP_056537
OMIM: 604647
HGNC: 17938
Ensembl: ENSG00000130643
Vega: OTTHUMG00000019310
Pharos: Q9NYX4(Tbio)
UniProt: Q9NYX4
Position
10q26.3
AA seq 217 aa AA seqDB search
MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPD
QQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLR
HKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPT
QAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagctgggctgcagcttctctgggaagccaggtaaagaccctggggaccaggat
ggggctgccatggacagtgtgcctctgatcagccccttggacatcagccagctccagccg
ccactccctgaccaggtggtcatcaagacacagacagaataccagctgtcctccccagac
cagcagaatttccctgacctggagggccagaggctgaactgcagccacccagaggaaggg
cgcaggctgcccaccgcacggatgatcgccttcgccatggcgctactgggctgcgtgctg
atcatgtacaaggccatctggtacgaccagttcacctgccccgacggcttcctgctgcgg
cacaagatctgcacgccgctgaccctggagatgtactacacggagatggaccccgagcgc
caccgcagcatcctggcggccatcggggcctacccgctgagccgcaagcacggcacggag
acgccggcggcctggggggacggctaccgcgcagccaaggaggagcgcaaggggcccacc
caggctggggcggcggcggcggccaccgaaccccccgggaagccgtcggccaaggcggag
aaggaggcggcgcggaaggcggccgggagcgcggcgcccccgcccgcgcagtga

DBGET integrated database retrieval system