KEGG   Homo sapiens (human): 50632Help
Entry
50632             CDS       T01001                                 

Gene name
CALY, DRD1IP, NSG3
Definition
(RefSeq) calcyon neuron specific vesicular protein
  KO
K15493  
neuron-specific vesicular protein calcyon
Organism
hsa  Homo sapiens (human)
Pathway
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    50632 (CALY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NYX4(Tbio)
UniProt: 
Position
10q26.3
AA seq 217 aa AA seqDB search
MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPD
QQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLR
HKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPT
QAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagctgggctgcagcttctctgggaagccaggtaaagaccctggggaccaggat
ggggctgccatggacagtgtgcctctgatcagccccttggacatcagccagctccagccg
ccactccctgaccaggtggtcatcaagacacagacagaataccagctgtcctccccagac
cagcagaatttccctgacctggagggccagaggctgaactgcagccacccagaggaaggg
cgcaggctgcccaccgcacggatgatcgccttcgccatggcgctactgggctgcgtgctg
atcatgtacaaggccatctggtacgaccagttcacctgccccgacggcttcctgctgcgg
cacaagatctgcacgccgctgaccctggagatgtactacacggagatggaccccgagcgc
caccgcagcatcctggcggccatcggggcctacccgctgagccgcaagcacggcacggag
acgccggcggcctggggggacggctaccgcgcagccaaggaggagcgcaaggggcccacc
caggctggggcggcggcggcggccaccgaaccccccgggaagccgtcggccaaggcggag
aaggaggcggcgcggaaggcggccgggagcgcggcgcccccgcccgcgcagtga

DBGET integrated database retrieval system