KEGG   Homo sapiens (human): 50649Help
Entry
50649             CDS       T01001                                 

Gene name
ARHGEF4, ASEF, ASEF1, GEF4, STM6
Definition
Rho guanine nucleotide exchange factor (GEF) 4
Orthology
K05769  
Rho guanine nucleotide exchange factor 4
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    50649 (ARHGEF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q22
AA seq 690 aa AA seqDB search
MPWEEPAGEKPSCSHSQKAFHMEPAQKPCFTTDMVTWALLCISAETVRGEAPSQPRGIPH
RSPVSVDDLWLEKTQRKKLQKQAHVERRLHIGAVHKDGVKCWRKTIITSPESLNLPRRSH
PLSQSAPTGLNHMGWPEHTPGTAMPDGALDTAVCADEVGSEEDLYDDLHSSSHHYSHPGG
GGEQLAINELISDGSVVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGE
GWFPASFVRLRVNQDEPADDDAPLAGNSGAEDGGAEAQSSKDQMRTNVINEILSTERDYI
KHLRDICEGYVRQCRKRADMFSEEQLRTIFGNIEDIYRCQKAFVKALEQRFNRERPHLSE
LGACFLEHQADFQIYSEYCNNHPNACVELSRLTKLSKYVYFFEACRLLQKMIDISLDGFL
LTPVQKICKYPLQLAELLKYTHPQHRDFKDVEAALHAMKNVAQLINERKRRLENIDKIAQ
WQSSIEDWEGEDLLVRSSELIYSGELTRVTQPQAKSQQRMFFLFDHQLIYCKKDLLRRDV
LYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKA
FAREREQVQLDQETGFSITELQRKQAMLNASKQQVTGKPKAVGRPCYLTRQKHPALPSNR
PQQQVLVLAEPRRKPSTFWHSISRLAPFRK
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgccctgggaagaaccagcaggtgagaagcccagttgctctcacagtcagaaggcgttc
cacatggagcctgcccagaagccctgcttcaccactgacatggtgacatgggccctcctc
tgcatctctgcagagactgtgcgtggggaggctccttcacagcctaggggcatccctcac
cgctcgcccgtcagtgtggatgacctgtggctggagaagacacagagaaagaagttgcag
aagcaggcccacgtcgaaaggaggctgcacataggggcagtgcacaaagatggagtcaag
tgctggagaaagacgatcattacctctccagagtctttgaatctccctagaagaagccat
ccactctcccagagtgctccaacgggactgaaccacatgggctggccagagcacacacca
ggcactgccatgcctgatggagctctggacacagctgtctgcgctgacgaagtggggagc
gaggaggacctgtatgatgacctgcacagctccagccaccactacagccaccctggaggg
ggtggggagcagctggctatcaatgagctcatcagcgatggcagtgtggtctgcgctgaa
gcactctgggaccatgtcaccatggacgaccaggagctgggcttcaaagctggggacgtc
atcgaagtgatggatgccaccaacagagagtggtggtggggccgggtcgccgatggcgag
ggctggtttccagccagcttcgttcggctgagggtgaatcaggacgagcccgcggatgac
gacgcccctctggccgggaacagcggagcggaggacggcggggcggaggcgcagagcagc
aaggaccagatgcggaccaacgtcatcaacgagatcctcagcactgagcgggactacatc
aagcacctgcgcgacatctgcgagggctacgtccggcagtgccgcaagcgcgcagacatg
ttcagcgaggagcagctgcgtaccatcttcgggaacatcgaggacatctaccgctgccag
aaggccttcgtgaaggccctggagcagaggttcaaccgcgagcgcccacacctgagcgag
ctgggtgcctgcttcctggagcatcaagccgacttccagatctactcggagtactgcaat
aaccaccccaacgcctgcgtggagctctcccggctcaccaagctcagcaagtacgtgtac
ttcttcgaggcctgccggctgctgcagaagatgattgacatctccctggatggcttcctg
ctgactccggtgcagaagatctgcaagtaccctctgcagctggccgagctgctcaaatac
acgcacccccagcacagggacttcaaggatgttgaagccgccttgcatgccatgaagaac
gtggcccagctcatcaacgagcggaagcggagacttgagaacatcgacaagattgctcag
tggcagagctccatagaggactgggagggagaagatctcttggtcaggagctcagaactc
atctactcgggggagctgactcgagttacacagcctcaagccaaaagccagcagcgaatg
ttctttctctttgaccaccagctcatctactgtaagaaggacctgctccgccgcgacgtg
ttgtactacaagggccggctggacatggacggcctggaggtggtggacctggaggacggg
aaggacagagacctccatgtgagcatcaagaacgccttccggctgcaccgtggcgccaca
ggggacagccacctgctgtgcaccaggaagcccgagcagaagcagcgctggctcaaggcc
tttgccagggagagggagcaggtgcagctggaccaggagacaggcttctccatcactgaa
ctgcagaggaagcaggccatgctgaatgccagcaagcagcaggtcacagggaagcccaaa
gctgttggccggccctgctacctgacgcgccagaagcacccagccctgcccagcaaccgg
ccccagcagcaggtcctggtgctggcggagcccaggcgcaagccatctaccttctggcac
agcatcagccggctggcacccttccgcaagtga

DBGET integrated database retrieval system