KEGG   Homo sapiens (human): 5073Help
Entry
5073              CDS       T01001                                 

Gene name
PARN, DAN, DKCB6, PFBMFT4
Definition
(RefSeq) poly(A)-specific ribonuclease
  KO
K01148  
poly(A)-specific ribonuclease [EC:3.1.13.4]
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    5073 (PARN)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     5073 (PARN)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     5073 (PARN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13
AA seq 639 aa AA seqDB search
MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKH
SMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQG
FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKF
IDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIV
ISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQF
YCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKV
ESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFN
KLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTS
AFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLN
PQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEP
LSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggagataatcaggagcaattttaagagtaatcttcacaaagtgtaccaggccatagag
gaggccgacttcttcgccatcgatggggagttttcaggaatcagtgatggaccttcagtc
tctgcattaacaaatggttttgacactccagaagagaggtatcagaagcttaaaaagcat
tccatggactttttgctatttcagtttggcctttgcacttttaagtatgactacacagat
tcaaagtatataacgaagtcatttaacttctatgttttcccgaaacccttcaatagatcc
tcaccagatgtcaaatttgtttgtcagagctccagcattgactttctagcaagccaggga
tttgattttaataaagtttttcgaaatggaattccatatttaaatcaggaagaagaaaga
cagttaagagagcagtatgatgaaaaacgttcacaggcgaatggtgcaggagctctgtcc
tatgtatctcctaacacttcaaaatgtcctgtcacgattcctgaggatcaaaagaagttt
attgaccaagtggtagagaaaatagaggatttattacaaagtgaagaaaacaagaacttg
gatttagagccatgtaccgggttccaaagaaaactaatttatcagactttgagctggaag
tatccgaaaggcattcatgttgagactttagaaactgaaaagaaggagcgatatatagtt
atcagcaaagtagatgaagaagaacgcaaaagaagagagcagcagaaacatgccaaagaa
caggaggagctgaatgatgctgtgggattttctagagtcattcacgccattgctaattcg
ggaaaacttgttattggacacaatatgctcttggacgtcatgcacacagttcatcagttc
tactgccctctgcctgcggacttaagtgagtttaaagagatgacaacatgtgttttcccc
agactcttggatactaaattgatggccagcacacaaccttttaaggatatcattaacaac
acatcccttgcggaattggaaaagcggttaaaagagacacctttcaaccctcctaaagtt
gaaagtgccgaaggttttccaagttatgacacagcctctgaacaactccacgaggcaggc
tacgatgcctacatcacagggctgtgcttcatctccatggccaattacctaggttctttt
ctcagccctccaaaaattcatgtgtctgccagatcaaaactcattgaacctttttttaac
aagttatttcttatgagggtcatggatatcccctatctaaacttggaaggaccagacttg
cagcctaaacgtgatcatgttctccatgtgacattccccaaagaatggaaaaccagcgac
ctttaccagcttttcagtgcctttggtaacattcagatatcctggattgatgacacatca
gcatttgtttcccttagccagcccgagcaagtaaagattgctgtcaataccagcaaatat
gcagaaagctatcggatccaaacctatgctgaatatatggggagaaaacaggaagagaag
cagatcaaaagaaagtggactgaagatagctggaaggaggctgacagcaaacggttaaac
ccccagtgcataccctacaccctgcagaatcactattaccgcaacaatagttttacagct
cccagcacagtaggaaagagaaatttgagtcctagtcaagaggaagctggcctggaggac
ggagtgtcaggggagatttccgacactgagcttgagcagaccgattcctgtgcagagccc
ctctcagagggaaggaaaaaggccaagaaattaaaaagaatgaagaaggagctttctcca
gcaggaagcatctcgaagaacagccctgccacactctttgaagttcctgacacatggtaa

DBGET integrated database retrieval system