KEGG   Homo sapiens (human): 5079Help
Entry
5079              CDS       T01001                                 

Gene name
PAX5, ALL3, BSAP
Definition
(RefSeq) paired box 5
  KO
K09383  
paired box protein 5
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Disease
H00001  
B lymphoblastic leukemia/lymphoma
H00011  
Lymphoplasmacytic lymphoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    5079 (PAX5)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Paired box domain only
    5079 (PAX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q02548(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
9p13.2
AA seq 391 aa AA seqDB search
MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRV
SHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLA
ERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYS
ISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRV
FERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYP
IVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRF
PNPGLLGSPYYYSAAARGAAPPAAATAYDRH
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggatttagagaaaaattatccgactcctcggaccagcaggacaggacatggaggagtg
aatcagcttgggggggtttttgtgaatggacggccactcccggatgtagtccgccagagg
atagtggaacttgctcatcaaggtgtcaggccctgcgacatctccaggcagcttcgggtc
agccatggttgtgtcagcaaaattcttggcaggtattatgagacaggaagcatcaagcct
ggggtaattggaggatccaaaccaaaggtcgccacacccaaagtggtggaaaaaatcgct
gaatataaacgccaaaatcccaccatgtttgcctgggagatcagggaccggctgctggca
gagcgggtgtgtgacaatgacaccgtgcctagcgtcagttccatcaacaggatcatccgg
acaaaagtacagcagccacccaaccaaccagtcccagcttccagtcacagcatagtgtcc
actggctccgtgacgcaggtgtcctcggtgagcacggattcggccggctcgtcgtactcc
atcagcggcatcctgggcatcacgtcccccagcgccgacaccaacaagcgcaagagagac
gaaggtattcaggagtctccggtgccgaacggccactcgcttccgggcagagacttcctc
cggaagcagatgcggggagacttgttcacacagcagcagctggaggtgctggaccgcgtg
tttgagaggcagcactactcagacatcttcaccaccacagagcccatcaagcccgagcag
accacagagtattcagccatggcctcgctggctggtgggctggacgacatgaaggccaat
ctggccagccccacccctgctgacatcgggagcagtgtgccaggcccgcagtcctacccc
attgtgacaggccgtgacttggcgagcacgaccctccccgggtaccctccacacgtcccc
cccgctggacagggcagctactcagcaccgacgctgacagggatggtgcctgggagtgag
ttttccgggagtccctacagccaccctcagtattcctcgtacaacgactcctggaggttc
cccaacccggggctgcttggctccccctactattatagcgctgccgcccgaggagccgcc
ccacctgcagccgccactgcctatgaccgtcactga

DBGET integrated database retrieval system